SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037464 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037464
Domain Number 1 Region: 741-888
Classification Level Classification E-value
Superfamily Spectrin repeat 2.51e-39
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 203-357
Classification Level Classification E-value
Superfamily Spectrin repeat 3.82e-37
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 3 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-34
Family Spectrin repeat 0.0000517
Further Details:      
 
Domain Number 4 Region: 416-569
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-32
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 5 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-30
Family Spectrin repeat 0.0000151
Further Details:      
 
Domain Number 6 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 7 Region: 1057-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 8 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 9 Region: 1244-1309
Classification Level Classification E-value
Superfamily EF-hand 0.000000000218
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037464
Domain Number - Region: 1208-1232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0267
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037464   Gene: ENSCJAG00000020080   Transcript: ENSCJAT00000039573
Sequence length 1312
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:172502335:172586455:1 gene:ENSCJAG00000020080 transcript:ENSCJAT00000039573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDDNYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVKEKLTILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPTQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIESAFRALSSEG
KPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN
Download sequence
Identical sequences F7BY82
ENSCJAP00000037464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]