SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037479 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037479
Domain Number 1 Region: 748-888
Classification Level Classification E-value
Superfamily Spectrin repeat 4.1e-38
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 203-352
Classification Level Classification E-value
Superfamily Spectrin repeat 6.89e-35
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 1819-1974
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-35
Family Spectrin repeat 0.00000193
Further Details:      
 
Domain Number 4 Region: 521-673
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-34
Family Spectrin repeat 0.0000536
Further Details:      
 
Domain Number 5 Region: 1499-1654
Classification Level Classification E-value
Superfamily Spectrin repeat 6.45e-33
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 6 Region: 1287-1424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-32
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 7 Region: 416-569
Classification Level Classification E-value
Superfamily Spectrin repeat 5.56e-32
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 8 Region: 1730-1862
Classification Level Classification E-value
Superfamily Spectrin repeat 8.08e-32
Family Spectrin repeat 0.00000211
Further Details:      
 
Domain Number 9 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-30
Family Spectrin repeat 0.0000151
Further Details:      
 
Domain Number 10 Region: 680-783
Classification Level Classification E-value
Superfamily Spectrin repeat 9.21e-29
Family Spectrin repeat 0.0000812
Further Details:      
 
Domain Number 11 Region: 1924-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-28
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 12 Region: 1661-1763
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-26
Family Spectrin repeat 0.00000159
Further Details:      
 
Domain Number 13 Region: 2086-2199
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 14 Region: 2308-2465
Classification Level Classification E-value
Superfamily EF-hand 5.98e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 15 Region: 2201-2316
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 16 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 17 Region: 1057-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 18 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-19
Family Spectrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037479
Domain Number - Region: 1208-1232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0555
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037479   Gene: ENSCJAG00000020080   Transcript: ENSCJAT00000039588
Sequence length 2472
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:172502332:172586253:1 gene:ENSCJAG00000020080 transcript:ENSCJAT00000039588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDDNYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVKEKLTILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPTQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEEKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERG
ACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL
LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRD
TINGRFQKIKSMAASRRARLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQ
NLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAA
ARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFT
VHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQ
FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK
DQLLAAKHIQSKAIEARHASLMKRWSQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKA
SAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSF
RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQW
IQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDN
KYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKS
GRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRET
ENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAF
DYVEFTRSLFVN
Download sequence
Identical sequences F7BGV8
ENSCJAP00000037479 XP_002743402.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]