SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037485 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037485
Domain Number 1 Region: 741-888
Classification Level Classification E-value
Superfamily Spectrin repeat 5.83e-39
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 203-357
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-36
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 3 Region: 1824-1979
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-35
Family Spectrin repeat 0.00000193
Further Details:      
 
Domain Number 4 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-34
Family Spectrin repeat 0.0000517
Further Details:      
 
Domain Number 5 Region: 1287-1429
Classification Level Classification E-value
Superfamily Spectrin repeat 6.12e-33
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 6 Region: 416-569
Classification Level Classification E-value
Superfamily Spectrin repeat 3.5e-32
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 7 Region: 1735-1867
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-32
Family Spectrin repeat 0.00000211
Further Details:      
 
Domain Number 8 Region: 1395-1536
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-32
Family Spectrin repeat 0.0000335
Further Details:      
 
Domain Number 9 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-30
Family Spectrin repeat 0.0000151
Further Details:      
 
Domain Number 10 Region: 1632-1765
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-29
Family Spectrin repeat 0.00000183
Further Details:      
 
Domain Number 11 Region: 1929-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-28
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 12 Region: 2091-2204
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 13 Region: 1499-1627
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-24
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 14 Region: 2312-2469
Classification Level Classification E-value
Superfamily EF-hand 5.98e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 15 Region: 1207-1302
Classification Level Classification E-value
Superfamily Spectrin repeat 4.64e-23
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 16 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 17 Region: 2206-2320
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.00093
Further Details:      
 
Domain Number 18 Region: 1057-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 19 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-19
Family Spectrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037485   Gene: ENSCJAG00000020080   Transcript: ENSCJAT00000039594
Sequence length 2476
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:172502332:172586556:1 gene:ENSCJAG00000020080 transcript:ENSCJAT00000039594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDDNYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVKEKLTILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPTQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEEKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNS
LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS
EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV
KDKRDTINGRFQKIKSMAASRRARLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD
LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKEL
KQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAF
ETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDEN
SAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIAN
ITALKDQLLAAKHIQSKAIEARHASLMKRWSQLLANSATRKKKLLEAQSHFRKVEDLFLT
FAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDR
QIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN
AFHQWIQETRCQPTGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEAL
ILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFD
KDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMI
SRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGREL
PTAFDYVEFTRSLFVN
Download sequence
Identical sequences F7AZ46
ENSCJAP00000037485 ENSCJAP00000037332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]