SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037593 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037593
Domain Number 1 Region: 1141-1238
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-24
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037593   Gene: ENSCJAG00000020212   Transcript: ENSCJAT00000039711
Sequence length 1249
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:84787493:84877297:-1 gene:ENSCJAG00000020212 transcript:ENSCJAT00000039711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHSQKELDLQNGSLKGDSVVHSTENDFQNVMESLSPKKYSSSLRFKANGDYSGSYLTL
SQPVPAKRSPSPVATSVRSSSSLAKIQGSKQFSYDGTDKTISMKPPTPSLSITSSLSGYP
LGRADFDPYSGRDSERAWRLSEKPPYSKHSSRNKSHDNVCFLGGLEGRQASGSLLAMWNG
SSLSDAGPPPLSRSGAASTPSSPKQGRKMSIQDSLLLQPKLTRHKELASENINLRTRKYP
SSSLSHMGAYSRSLPRLYKATENQLTPLSLPPRNSLGNSKRTKLGEKDLPHSIIDNDNYL
NFSSLSSGALPYKTSASDGNPYVSSTLSVPASPRVARKMLLASTSSCVSDDFDRASYAGT
NSSHSLLAEESDRVFVTRRNFSCGSVESDEADLESLRQALGTPQPVLRERKSSISSISGR
EDLMDYHRRQREERLREQEMERLERQRLETILNLCAEYTKPDSCLSTGTTVADVQKINKE
LEKLQLSDEESVFEEALISPDTRYRCHRQDSLHDADLASCGILSQSSASFLTPRSSRNDE
VLSDLTRTPPPPSSTFPKASSESSYLSILPKTPEDISEEQRSQELAAIEETRIVVLNNLE
ELKQKIKDINDQMDESSRELDMECALLDGEQQSETTELMKEKEILDHLNRKIAELEKNIV
GEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESKHF
EDLEFQQLERESRLDEEKENLTQQLLREVAEYQRNIVSRKEKISALKKQANHIVQQAQRE
QDHFVKEKNNLIMMLQREKENLCNLEKKYSSLSGGKGFPINPNTLKEGYISVHEINEPCG
NSTHLSPSTQFPADAVATEPATAVLASQPQSKEHFRSLEERKKQHKEGLYLSDTLPRKKT
TSSISPHFNSATMGRSITPKAHLPLGQSNSCGSVLPPSLAAMAKDSESRRMLRGYNHQQM
SEGHRQKQEFYNRTASESNVYLHSFHYPDHSYKDQACDTLSLDSSDSMETSISACSPDNI
SSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRREILEKRLLEE
TSQRQKLIEKEVKIREKQRAQARPLTRYLPVRKEDFDLRSHVETAGHNIDTCYHVSITEK
ACRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVIYFQAIEEVYYDHLKN
ANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL
Download sequence
Identical sequences F6VEC5
ENSCJAP00000037593 ENSCJAP00000037593 XP_008980735.1.60252 XP_008980736.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]