SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038484 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038484
Domain Number 1 Region: 74-260
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.48e-70
Family T-box 0.00000151
Further Details:      
 
Domain Number 2 Region: 2425-2505
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038484   Gene: ENSCJAG00000020688   Transcript: ENSCJAT00000040659
Sequence length 3066
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:34122180:34235704:-1 gene:ENSCJAG00000020688 transcript:ENSCJAT00000040659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKQQIILANQDGGTVAGAAPTFFVILKQPGNGKTDQGILVTNQDACALTSSVSSPVKS
KGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNSKPQRDGKQKNSSDQEGNNISSSSGHRVRLTEGQGS
EIQPGDSDPLSRGHETSGKGLEKTSLNIKRDFLGFMDTDSALSEVPQLKQEISECLIANN
FEDDSHITSPLDQNGSFNVVIKEEPLDDYDYEFGECPERVTVKQEETDEETDVYSNSDDD
PILEKQLKRHNKVDNPEADHLSSKWLPSSPSGVAKAKMFKLDAGKMPVVYLEPCAVTKST
VKISELPDNMLSTSRKDKSSMLTEFEYLPTYIENSNETAFCLGKESENGLRKHSPDLRVV
QKYPLLKEPLWKYPNISDSISTERIFDSSKGSAGDSLSGKEELGRKRTTMLKIATAPKVV
NANQNASPNIPGKRGRPRKLKLCKAGRPPKNTGKSLISTKNTPVGPGSTFPDVKPDLEDV
DGVLFVSFESKEALDIHAVDGTTEESSGLQASTTNDSGCRARISQLEKELIEDLKSLRHK
QVIHPGLQEVGLKLNSVDPTMSIDLKYLGVQLPLAPATSFPFWNLTGTNPASPDAGFPFV
SRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSDKLDEYLENEGKLMET
SMGFSSNAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVAPASRKAKS
QNRQATFSGRTKSSYKSILPYPVSPKQKYSHMILGDKVTKNSSGTISENQANNFVVPTLD
ENTFPKQISLRQAQQQQQQQQQQGSRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERAD
VSLTTLLTAQASLKTKPIHTIIRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMF
GCTCLKRKVVLVKGGSKTKHFQRKAAHRDPIVYDTLGEEAREEEEGVKEEEEQLKEKKKR
KKLEYTICETEPEQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSTTV
KGRLVPGIKSARSYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYERKKEDQRQLSSSS
SPSPSFQQQNSCHSSPENHNNAKEPDSEQQPLKQLTCDLEDDSGKLQEKSWKSSCNEGES
SSTSYMHQRSPGGPTKLIEIISDCNWEEDRNKILSILSQHINSNMPQSLKVGSFIIELAS
QRKSRGEKNPPVYSSRVKISMPSCQDQDDMAEKSGSETPDGPLSPGKMEDISPVQTDALD
SVRERLHGGKGLPFYAGLSPAGKLVAYKRKPSSSTSGLIQVASNAKVAASRKPRTLLPST
SNSKMASSSGAPTNRPGKNLKAFVPAKRPIAARPSPGGVFTQFVMSKVGALQQKIPGVST
PQTMGGPQKFNIRPSPVMVVTPVVSSEPVQVCSPVTAAVTTTTPQVFLENVTAVTPMTAI
SDVETKETTYSSGATTTGVEVSETSISTPVTSTQSTATVNLTKTTGITTPVASVAFPKSL
VASPPTITLPVASTASTSLVVVTTAASSSVVTTPTSSLGSVPIILSGINGSPPVSQRPEN
AAQIPVATPQVSSNTVKRAGPRLLLIPVQQGSPSLRPVSNTQLQGHRMVLQPVRSPSGMN
LFRHPNGQIVQLLPLHQLRGSNTQPNLQPVMFRNPGSVMGIRLPAPSKPSETPPSSTSSS
AFSVMNPVIQAVGSSAVNVITQAPSLLSSGASFVSQAGTLTLRISAPEPQSFASKTGSET
KITYSSGGQPVGTASLIPLQSGSFALLQLPGQKPVPSSILQHVASLQMKRESQNPDQKDG
KNSIKREEETKKVLQSEGQAVDPEANTVKQNSGAATSEETLNDSLEDRSDHLDEESLREE
GSATVKPSKHSCITGSHRDEDYKDVNEECGARNHKSSKEKVAVLEVRTISEKASNKTVQN
MSKVQHQKLGDRKVEQQKGLDNPEENSNEFPDISKEESKFELSGSKGVEQQSHPQTEATE
KECGDSLEKDSIRERWRRHLKGPLTRKCVGASQECKQEADEQLIKETKTCQENSDVFQQQ
QSISDLLGKRGITEDASVLKTECDSWSRISSPSAFSIVPRRAAKSSRGNGHFQGHLLLPG
EQIQPKQKKKSGRSSADLTVFDLEEDEDENEKTDDSIDETVDVVSDYQSEEVDDIEKNNC
VEYIEDDEEHVDIETVEELSDEINVAHLKTTAVHTESFKQPCRTHISADEKAAERSRKAP
PIPLKLKPDYWSDKLQKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLHSSKVS
KSHILTRAFSEIQGLTDQADKLIGQKNLLTRKRNILIRKVSSLSGKTEEVVLKKLEYIYA
KQQALEAQKRKKKMGSDEFDMSPRISKQQEGSSASSVDLGQMFINNRKGKPLILSRKKDQ
ATENTSPSNTPHTSANLVMTPQGQLLTLKGPLFSGPVVTVSPDLLESDLKPQVASSAMAQ
PENDDLFMMPRIVNVTSLATEGGLIDMGGSKYPHEVPDGKPSDHLKDTVRNEDNSLEDKG
RISSRGNRDGRVTLGPSQIFLANKDSGYPQIVDVSSMQEAQEFLPKKISGDRRGIQYKWK
ESELRGERVKSKESSFHKLKIKDLKDSSIEMELRKVTSAIEEAALDPSELLTNMEDEDDT
DETLTSLLNEIAFLNQQLNDDSVSLAELPSSVDTEFPGDARQSFISKVPPGNRATFQVEH
LGAGLKELPDVQGESDSISPLLLHLEDDDFSENEKQLAEPASEPDVLKIVIDSEIKDSLL
SNKKDTDGGKNTSGLPAEPESVSSPPILHMKTGLENSNSTDTLWRPMPKLAPLGLKVANP
SSDVDGQNLKVMPCLAPIAAKVGSVGHKMNLTGNDQEGRESKVMPTLAPVMAKLGNLGAS
PGSAGK
Download sequence
Identical sequences F7INH6
XP_002753560.1.60252 ENSCJAP00000038484 ENSCJAP00000038473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]