SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038510 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038510
Domain Number 1 Region: 220-416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-39
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 79-149
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000184
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038510   Gene: ENSCJAG00000020706   Transcript: ENSCJAT00000040685
Sequence length 419
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:30377007:30382615:-1 gene:ENSCJAG00000020706 transcript:ENSCJAT00000040685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWRDWPRLRLLKREAIPGEGQKAAKVNAGVGEKGIYTASSRGGPPSARSKAVAVVAERA
ASRSRLSMDAPELGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARRWGTPPA
TGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELRQKLAEPGALAGRRRGGRIPTM
GSLDPHGEDMRKTWRRFEVPAPKSPNPEADLPEDYPVVKNMLHRLTADLTLDPGTAHHRL
LISADRRSVQLAPPGTPSPPDAPTRFDQLPAVLGAQGFGAGRHCWEVETGDAASCRDSSG
EDEDDGESHYAVGAAGESVQRKGRVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGAEPP
PRRIRVDLDWERGRVAFYDGRSLDLLFAFQAPGPLGERIFPLFCTRDPRAPLRIVPAES
Download sequence
Identical sequences F7IGC4
ENSCJAP00000038510 ENSCJAP00000038502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]