SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038951 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038951
Domain Number 1 Region: 774-955
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 930-1049
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 159-192,232-378
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-31
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-20
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038951   Gene: ENSCJAG00000020921   Transcript: ENSCJAT00000041143
Sequence length 1169
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:152704121:152952193:-1 gene:ENSCJAG00000020921 transcript:ENSCJAT00000041143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHLLPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSSRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKE
DADHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSRGSESPRPGPPHAATTGGCQEPGCRPMRKSFSQP
GLRSLAFRKELQDAGLRASGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSE
VYLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEAL
VDEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLT
TLTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQISQIAAEN
IGSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSTSVDLDSSVSSTLS
NTSKEPSVCEKEALPISKSSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSH
FPMECQESPQPARGSPGVSQRKLLRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRH
SWRQQIFLRVATPQKACDSPSRYEDYSELGELPPRSPLEPVCEDGPFGPAPEEKKRTSRE
LRELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLS
TPGRSKIKFDMEKMHLAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLK
QLTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGI
LLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHE
IGPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENL
ETIVDFIKNTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQR
MDKLEKSNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSNESKLKQAMLTLELERSAL
LQSVEELRRRSAEPSRLGSEHAQPEPTGD
Download sequence
Identical sequences F7IN41
ENSCJAP00000038951 ENSCJAP00000044141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]