SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039408 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039408
Domain Number 1 Region: 828-1009
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-41
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 
Domain Number 2 Region: 984-1105
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-31
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Domain Number 3 Region: 191-221,313-441
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000039408
Domain Number - Region: 436-497
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0602
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039408   Gene: ENSCJAG00000021156   Transcript: ENSCJAT00000041631
Sequence length 1235
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:39200332:39379997:1 gene:ENSCJAG00000021156 transcript:ENSCJAT00000041631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQDEPFPHPLEPEPGVPAQPGPGKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSQKPEVGGCGGPAAREVILVLSAPFLRCVPAPGAGASGGSSPSAAQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQ
GEQRGADPGEDLADLEVVVPGSPADCLPEEADGTNTHPGLPGGASQPALTSSRVCLPERI
LEDSGFDEQQEFRSRCSSVTGVQRRVQESSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQ
VGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVI
QRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHVHIGEGPSTIS
NSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLAS
EKDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSSKRKLNLQDGR
AQSVRSPLLRQSSSEQYSDGEGRKRTSSSCSNESLSVGGTSVTPRRISWRQRIFLRVASP
MNKSPSAMQQQDGLDRSELLPLSPLSPTMEEEPLVIFLSGEDDREKIEERKKSKELRSLW
RKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGVCQKEVLITWDKKLLNCRAK
IRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQ
HAILVDLGRTFPTHPYFSVQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMS
EEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLY
AAPWFLTLFASQFSLGFVARAFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEF
LKSTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYACEDTEPLEKLE
RANSQLKRQNMDLLEKLQVAHAKIQTLESNLENLLTRETKMKSLIRTLEQEKMTYQKTVE
QLRKLLPADALANCELLLRDLNCNPNNKAKIGNKP
Download sequence
Identical sequences F7GPG1
ENSCJAP00000039408 XP_002742618.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]