SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039710 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039710
Domain Number 1 Region: 2213-2450
Classification Level Classification E-value
Superfamily Plakin repeat 5.49e-84
Family Plakin repeat 0.000000000528
Further Details:      
 
Domain Number 2 Region: 1971-2206
Classification Level Classification E-value
Superfamily Plakin repeat 1.13e-75
Family Plakin repeat 0.00000256
Further Details:      
 
Domain Number 3 Region: 2524-2564,2611-2805
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-67
Family Plakin repeat 0.00000000877
Further Details:      
 
Domain Number 4 Region: 839-967,994-1021
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 5 Region: 329-458
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000101
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 6 Region: 2463-2517
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000602
Family Plakin repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 192-275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000118
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039710   Gene: ENSCJAG00000021333   Transcript: ENSCJAT00000041953
Sequence length 2872
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:21037517:21085239:-1 gene:ENSCJAG00000021333 transcript:ENSCJAT00000041953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCNGGSHPRINTLGRLTRAESGPDLRYEVTCGGGGGGGTSRMYYSRRGVITDQNPDGYC
QTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDEYFAQANDQ
MEITDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSG
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRSIHNAIGDYRWQLDK
IKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYD
WSDRNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQ
WSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQ
IKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVH
KGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALW
NQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGS
EMFGDDDKRKMQSQFTDAQKHYQTLVIQLPGHPHHQTVTTTEITHVGTCQDVNHNKVIET
NRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQ
AIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAI
LQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQ
IHSQTSQQYPLYDLDLGKFSEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQA
FCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANS
IKDYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAADVHARYIELLTRSGDYYRFL
SEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLT
SLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKN
DYDQLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGARKREYENELAKVRN
HYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLN
DSILQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAA
KTIQDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTI
HQLTMQKEEDTSGYRAQIDSLTRENRSLSEEVKRLKNTLAQTTENLRRVEEDVQQHKATG
SEVSQRKQQLEVELRQVTQMRTEESLRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNER
KCLEDENARLQRVQYDLQKANSSVLETTNKLKVQEQELTRLRIDYERVSQERTVKDQDIT
RFQSSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQ
QLEQASIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQ
AHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRG
RSEADSDKNATISELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNR
IQESKTQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKATLEAETRVKQRLECEK
QQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKL
EDSTRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTA
MQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGAIAGASASPKEKYSLVEAKRK
KLISAESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYTAEKAITGFD
DPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRD
LYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPV
TVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEA
MKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVT
GYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVNIAYKRGYF
NEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKRQVQTSQ
KNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRV
VLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGGSMGSGVSD
DVFSSSRHESVSKLSTISNVRNLTIRSSSFSDPLEESSPIAAIFDTENLEKISITEGIER
GIVDSITGQRLLEAQACTGGIINPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAYIGFE
GVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGR
AAQRLQDTNSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNM
SSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH
Download sequence
Identical sequences F7DTB0
XP_002806728.1.60252 ENSCJAP00000039710 ENSCJAP00000039710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]