SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039717 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039717
Domain Number 1 Region: 2205-2441
Classification Level Classification E-value
Superfamily Plakin repeat 7.19e-81
Family Plakin repeat 0.000000000613
Further Details:      
 
Domain Number 2 Region: 1963-2198
Classification Level Classification E-value
Superfamily Plakin repeat 1.13e-75
Family Plakin repeat 0.00000256
Further Details:      
 
Domain Number 3 Region: 2515-2555,2602-2796
Classification Level Classification E-value
Superfamily Plakin repeat 9.59e-68
Family Plakin repeat 0.00000000877
Further Details:      
 
Domain Number 4 Region: 831-959,986-1013
Classification Level Classification E-value
Superfamily Spectrin repeat 6.66e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 5 Region: 321-450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000101
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 6 Region: 2454-2508
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000602
Family Plakin repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 184-267
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000118
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039717   Gene: ENSCJAG00000021333   Transcript: ENSCJAT00000041960
Sequence length 2863
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:21038352:21084961:-1 gene:ENSCJAG00000021333 transcript:ENSCJAT00000041960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCNGGSHPRINTLGRLTRAESGPDLRYEVTTSRMYYSRRGVITDQNPDGYCQTGTMSRH
QNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDEYFAQANDQMEITDSLI
REMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTK
HVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRSIHNAIGDYRWQLDKIKADLREK
SAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDRNTNI
AQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQIT
KCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKER
EKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILK
DNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMK
SLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDK
RKMQSQFTDAQKHYQTLVIQLPGHPHHQTVTTTEITHVGTCQDVNHNKVIETNRENDKQE
TWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIAEVLNQ
LKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQTEDMLK
VYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHSQTSQQ
YPLYDLDLGKFSEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCKWLYDA
KRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKDYELQL
ASYTSGLETLLNIPIKRTMVQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEMLKSLE
DLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLTSLEELKRQ
AELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKA
RQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGARKREYENELAKVRNHYNEEMSN
LRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSILQATE
QRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTIQDKNK
EIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQLTMQKE
EDTSGYRAQIDSLTRENRSLSEEVKRLKNTLAQTTENLRRVEEDVQQHKATGSEVSQRKQ
QLEVELRQVTQMRTEESLRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNERKCLEDENA
RLQRVQYDLQKANSSVLETTNKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQSSLKE
LQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLEQASIV
KKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHLRNEHF
QKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDK
NATISELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKTQC
TQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKATLEAETRVKQRLECEKQQIQNDLN
QWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQ
SQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQL
IDKTTLDKLLKGKKSVEEVASEIQPFLRGAGAIAGASASPKEKYSLVEAKRKKLISAEST
VMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYTAEKAITGFDDPFSGKTV
SVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDP
RDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVTELVDS
GILRPSTVNELESGQISYDEVGERKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPG
TALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGN
IISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVNIAYKRGYFNEELSEILS
DPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKRQVQTSQKNTLRKRRV
VIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDRKTGS
QYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGGSMGSGVSDDVFSSSRHE
SVSKLSTISNVRNLTIRSSSFSDPLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQ
RLLEAQACTGGIINPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAYIGFEGVKGKKKMS
AAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTN
SYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSG
SRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH
Download sequence
Identical sequences F7DT28
ENSCJAP00000039717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]