SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039988 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039988
Domain Number 1 Region: 2566-2806
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-87
Family Plakin repeat 0.0000000753
Further Details:      
 
Domain Number 2 Region: 2993-3231
Classification Level Classification E-value
Superfamily Plakin repeat 1.23e-86
Family Plakin repeat 0.0000000573
Further Details:      
 
Domain Number 3 Region: 3572-3806
Classification Level Classification E-value
Superfamily Plakin repeat 1.96e-86
Family Plakin repeat 0.0000000313
Further Details:      
 
Domain Number 4 Region: 1-222
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-86
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 5 Region: 3330-3567
Classification Level Classification E-value
Superfamily Plakin repeat 3.4e-78
Family Plakin repeat 0.000000747
Further Details:      
 
Domain Number 6 Region: 3832-3873,3908-4102
Classification Level Classification E-value
Superfamily Plakin repeat 2.96e-69
Family Plakin repeat 0.000000298
Further Details:      
 
Domain Number 7 Region: 238-354
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-22
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 632-759
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000122
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 9 Region: 485-578
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000055
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 10 Region: 1005-1159
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000039988
Domain Number - Region: 1115-1257
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 2894-2955
Classification Level Classification E-value
Superfamily Plakin repeat 0.00165
Family Plakin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039988   Gene: ENSCJAG00000021472   Transcript: ENSCJAT00000042244
Sequence length 4183
Comment pep:novel chromosome:C_jacchus3.2.1:16:50717751:50743676:1 gene:ENSCJAG00000021472 transcript:ENSCJAT00000042244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRF
HKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSED
MTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLE
NLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANEL
QLRWQEYRELVLLLLQWIRHHTATFEERRFPSSFEEIEILWCQFLKFKEMELPAKEADKN
RSKGIYQSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRI
VSKLQMEAGLCEEQLNQADALLQSVRGCPAAGRSKVPQRAGEVERDDKADGMIRLLFNDV
QTLDGRHPHGEQMYAQMVYRLHERLVAIRTEYNLRLKAGVAAPAVQVTQVTLQRRPEPED
STLRYLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLHQSIEEFRAKIERARSDE
GQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHSFVAAATKELMWLNEKEEEE
VGFDWSDRNTNMTAKKDSYSPWVEELELKEKKIKELQSAGDRLLREDHPGPGPPVESFQA
ALQTQWSWMLQLCCCIEAHLKENAAYFQFFSDVREAEEQLQKLQETLRRKYSCDRSITVT
RLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRHPAYPVRGRVPLLAVCDYKQV
EVTVHKGDECQLVGPAQPSNWKSRPAQAARPPVPSVCFLVPPPNQEAQEAVTRLEAQHQA
LVTLWHQLHVDMKSLLWQSLRRDVQLIRSWSLATFRTLKPEEQRQALHSLELHYQAFLRD
SQDAGGFGPEDRLVAEREYGSCSHHYQQLLQSLEQGAQEESRCQRCISELKDIRLQLEAC
ETRTVHRLRLPLDKEPARECAQRIAEQQAGASLPQVEGLGKGVARLSAEAEKVLALPEPS
PAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLRAHEEQLKEAQA
VPATLPELEATKASLKKLRAQAEAQQPVFDALRDELRGAQEVGERLQQRHGERDVEVERW
RERVAQLLERWQAILAQIDACPVAAMLTSPSPALLEEIERHGEKVEECQKFAKQYINAIK
DYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFISET
LRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAEREAKELQQRMQEE
VVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRLRIEEEIRVVRLQ
LEATERQRGGAEGELQALRERAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALR
VKAEAEAAREKQRALQSLEELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEAELQS
KRASFAEKTAQLERSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQLKANE
ALRLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQL
AEGTAQQRLAAEQELIRLRAETEQGEQQRLLLEEELTRLQREAAAATQKRQELEAELAKV
RAEMEVLLASKARAEEESRCTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLA
EEDAARQRAEAERVLAEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRL
EEQAAQHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEILALKASFEKAAAG
KAELELELGRIRSNAEDTLRSKEQAEQEAARQRQLAAEEEQRRREAEERVQKSLAAEEEA
ARQRKAALEEVERLKAKVEEARRLRERAEQESTRQLQLAQEAAQKRLQAEEKAHAFAVQQ
KEQELQETLQQEQSMLDRLRSEAEAARRAAEEAEEARVQAEREAAQSRRQVEEAERLKQS
AEEQAQAQAQAQAAAEKLRKEAEQEATRRAQAEQAALRQKQAADAEMEKHKKFAEQTLRQ
KAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAARQRSQVEEELFSVRVQMEEL
SKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEED
LAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAQE
TQGFQRTLEAERQRQLEMTAEAERLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRT
ELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLQQEAKLLQLKSEEMQTVQ
QEQLLQETQALQQSFLSEKDSLLQREHFIEQEKAKLEQLFQDEVAKAQQLREEQQRQQQQ
MEQERQQLVASMEEALRRQREAEEGVRRKQEELQRLEQQRRQQEELLAEENQRLREQLQR
LEEEHRAALAHSEEVTALQVAATKTLPNGQDALDGPAVEAEPKHSFDGLRRKVPAQRLQE
AGILSAEELHRLAQGHTTVHELARREDVRHYLQGSSSIAGLMLKPTNEKLSIYSALQRQL
LSPGTALILLEAQAASGFLLDPVQNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYTDP
YTGQPISLFQAMQKGLIVREHGIRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDEEMN
RILADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDLE
ARDVFEKATVSAPFGKFQGKTVTIWEIINSEYFTAEQRRDLLRQFRTGRITVEKIIKIII
TVVEEQEQKGQLCFEGLRSLVPAAELLESSVINRELYHQLQRGERSVREVAEVDAVRRAL
RGAGIIAGYFTAEQRQELLRQFRTGKVTVEKVIKILITIVEEVETQRQERLSFSGLRAPV
PASELLASGVLSRAQFEQLKDGKTTVKDLSELGSVQTLLQGSGCLAGIYLEEAKEKVSIY
EAMRRGLLRPSTAALLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEQLLSAEKA
VTGYRDPYSGSTISLFQAMQKGLVLRQHGIRLLEAQIATGGIIDPVHSHRVPVDVAYQRG
YFDQEMNRVLADPSDDTKGFFDPNTHENLTYRQLLERCVEDPETGLRLLPLKGAEKAEVV
ETTQVYTEEETRRAFEETQIDIPGGGSHGGSTMSLWEVMQSDLIPKEQRAQLMADFQAGR
VTKERMIIIIIEIIEKTEIIRQQGLASYDYVRRRLTAEDLYEARIISLETYNLLREGTRS
LREVLEAESAWRYLYGTGCVAGVFLPGSRQTLSIYQALKKGLLSAEVARLLLEAQAATGF
LLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKDLIP
AEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTD
ERLSYTQLLKRCRRDDSTGQLLLPLSDAHKLTFRGLRKQITVEELVRSQVMDEATALQLR
EGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAA
TGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKG
LILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFD
PNTEENLTYLQLMERCITDPQTGLYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQY
DIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNASGFRSRSSSVGSSSSYPISPAVS
RPQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRSLVDNITGQRLLEAQACTGGIID
PSTGERFPVTDAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALRKGWLYYEA
GQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLK
ISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRAGSRTGSRAGSRR
GSFDATGSGFSMTFSSSSYSSGYGRRYASGSSASLGGPESAVA
Download sequence
Identical sequences F7H3U7
ENSCJAP00000039988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]