SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040021 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040021
Domain Number 1 Region: 44-368
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.48e-77
Family Pancreatic carboxypeptidases 0.00000175
Further Details:      
 
Domain Number 2 Region: 368-447
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.94e-18
Family Carboxypeptidase regulatory domain 0.00088
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000040021
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0419
Family Frizzled cysteine-rich domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040021   Gene: ENSCJAG00000021495   Transcript: ENSCJAT00000042279
Sequence length 517
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:186615235:186648135:1 gene:ENSCJAG00000021495 transcript:ENSCJAT00000042279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPYFLDCHRYFKREDEGCYDPLEKLRGGLEADEVLPSGLPPTFIRFSHHSYAQMARVL
RRTAARCAHVARTYSIGRSFDGRDLLVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREM
LIYLTQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQ
NLDLNRNFPDLTSEYYRLAGTRSVRSDHIPIPEHYWWGKVAPETKAIMKWMQTIPFVLSA
SLHGGDLVVSYPFDFSKQPQEEKMFSPTPDEKTFKLLSRAYAEVHPMMMDRSENRCGGNF
LKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYTIWQHNKESLLN
FVETVHRGIKGVVMDKYGKPVKNARILVKGIRHDITTAPDGDYWRLLPPGTHIVIAQAPG
YARLIKKVIIPARMKRAGRVDFILQPLGVGPKNFLPGLRRTGPHDPLGGASPLGEGTEPN
PDPLRARRQPSAGGSKPWWWSYFTSLSAHRPRWLLKY
Download sequence
Identical sequences F7ILM9
ENSCJAP00000040021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]