SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042555 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042555
Domain Number 1 Region: 80-122
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000253
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042555   Gene: ENSCJAG00000012381   Transcript: ENSCJAT00000062944
Sequence length 143
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:75791208:76461876:-1 gene:ENSCJAG00000012381 transcript:ENSCJAT00000062944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSVETLNSTRQGTGAIQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHVLKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWVVLSSRKIEFYKES
KQQALSNMKTGHKPESVDLWCTH
Download sequence
Identical sequences F6V5X0
ENSCJAP00000042555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]