SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043080 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043080
Domain Number 1 Region: 12-142,173-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-78
Family Calponin-homology domain, CH-domain 0.0000295
Further Details:      
 
Domain Number 2 Region: 1610-1744
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 3 Region: 2445-2575
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-16
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 4 Region: 1392-1525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000262
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 5 Region: 2663-2788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000468
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 543-685
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000528
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 7 Region: 2233-2388
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000103
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 8 Region: 2817-2934
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000162
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 9 Region: 1909-2060
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000132
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 10 Region: 1699-1850
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000935
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 11 Region: 1073-1211
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000279
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 1502-1606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000671
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 13 Region: 2036-2137
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000183
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 14 Region: 2137-2266
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000036
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 15 Region: 873-999
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000129
Family Spectrin repeat 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000043080
Domain Number - Region: 772-906
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00122
Family Spectrin repeat 0.025
Further Details:      
 
Domain Number - Region: 1292-1388
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0959
Family Spectrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043080   Gene: ENSCJAG00000012842   Transcript: ENSCJAT00000054553
Sequence length 3032
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:153312914:153559321:-1 gene:ENSCJAG00000012842 transcript:ENSCJAT00000054553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRGTSRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSLVSSETPSPPSKRKVTTKIQGNA
KKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLEKVKGRSNRENLE
DAFSIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNVGTDGQEDDREDR
LILKEVKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGK
LSLDQALVKQSWDRVSSRLCDWHIHLDKSLPAPLGTIGAWLYRAEVALREEITIQQVHEE
TANMIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSE
LHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSFIENSKFFEQYE
VTYQILKQTAEMYIKADGSVEEAENVMKFMNETTAQWRNLSVEVRSVRSMLEEVISNWDR
YGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHWIQQHTAMNDAGNFLIETCNEMVSR
DLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCIVTLSAFATESHKKLSEPLEV
SFMNVKLLIQDLEDIEQRVPVMEAQYKIITKTAHLITKESPQEEGKEMFATMSKLKEQLT
KVKECYSPLLYECQQLLIPLEELEKQMTSFYDSLGKINEIITVLEHEAQSSALFKQKHQE
LLACQDNCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQIADVHVAFQSMVKKTGD
WKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELLRRHTEFFSQLDQRVLNA
FLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLLHLKIDVEKNRFLASVEE
CRAELDRETKLVPQEGSEKIIKEHRVFFSDKGPHHLCEKRLQLIEELCVKLPVRDPVRDT
PGTCHATLKDLRAAIDSTYRKLMEDPDKWKDYTSRFSEFSSWISTKETQLKGIKGEAIDT
ANHGEVKCAAEEIRTGITKRGETLSWLKSRLKVLTEVSSENEAQKQGDELATLSSSFKAL
SALLSEVEKMVSNFGDCVQYKEIVKNSLEELISGSKEAQEQAEKILDTENLFEAQQLLLH
HQQKTKRISAKKKDVQQQIAQAQQGETGLPDRSREELQKLESTLDGLERSRERQERRIQV
TLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELEQTKEFSKRTESIAVQAE
NLVKEASEVPLGPQNKQLLQQQAKSIKEQVKKLEDTLEEDIKTMEMVKTKWDHFGSNFET
LSAWITEKEKELNGLETSSSAMDMQISQIKVTIQEIESKLSSIIGLEEEAQSFAQFVTTG
ESARIKAKLTQIRRYWEELREHAQCLEGTILGHLSQQQKFEENLRKIQQSVSEFEDKLAV
PIKTCSSATETYKVLQEHMDLCQALESLRSPITAFSASARKVVNGDSCVQEAAALQQQYE
GTLRKAKERQTALENLLAHWQRLEKELSSFLTWLERCEAIASSPEMDISADRVKVESELQ
LIQALQNEVVSQASFYSKLLQLKESLFSVASKEDVKMLKLHLEQLDERWRDLPQIINKRI
NFLQSVVSEHQQFDELLLSFSIWIKLFLSELQATSEISIIDHQVALTRHKDHTADVESKK
GELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVVERRQLALSHLAEFLQSH
ASLSSVLHKLRQTVEATNSMNKNQSDLIEKNLNDAIQDAKALESTAVSLDGILSKAQYHL
KSGSSEQRTSCRATVDQLFGELERIQNLLGTKQSEADALAVLKKAFQDQKEELLKSIENI
EERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLKDKAKQIAQKDVAFAPEVD
REINRLEVTWDDTKRLIHENQGQCCGLIDLMREYQNLKSAVSKVLENASSVIVTRTTIKD
QEDLKWAFSKHETARNKMNYKQKDLDNFTSKGKHLLSELKKIHSSDFSLVKTDMESTMDK
WLDVTEKLEENMDRLRVSLSIWDDVLSSKDEIEGWSNNSVPQMAENISNLSNHRRAEELL
KEFESEVKNKALRLEELHSKVNDLKNLTKNPETPPDLRFIEADLRQKLEHAKEITEVAKG
TLKDFTAQSTQVEKFINDVTTWLTKVEESLMNCAQTETCEGLKKVKDIQKELQSQQSNIS
STQENLNSLCRKYHSAELESLGRAMTGLIKKHEAVSQLCSKTQASLQDSLEKHFSESMQE
FQEWFLGAKAAAKELSDRTGDSKVLEAKLQDLQNILDSVSDGQSKLDAVTQEGQTLYAHL
SKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCASELGSFEDQHRKLNLWIHEMEER
LNTENLGESKQHIPEKKNEVHKVEMFLGELLAARESLDKLSQRGQLLSEEGHGAGQEGRL
CSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEALQSMWSWVKVIQDRLACAESTLGSK
DTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQRVIQTQLETLKEVWADI
MSSSIHAQSTLESVISQWNAYLERKNQLEQWMESVDQKVEHPLQPQPGLKEKFTLLDHLQ
SVLSEAEDHSRALHRLNAKSRELYEKTGDESFKDTAQEELKTQFTDIMTVAKEKMRKVEE
IVKDHLMYLDAVQEFTDWLQSAKEELHRWSDMSGDSSATQKKLSKIKELIDSREIGASRL
SRVESLAPEVKQNTTASGCELMHTEMQALRADWKQWEDSVFQTQNRLEDLVSQMALSEQE
FSGQVAQLEQALEEFSALLKTWAQHLTLLEGKNTDEEIVECWHKGQEILDALQKAEPRTE
DLKSQLNELCRFSRDLSTYSGKVSGLIKEYNW
Download sequence
Identical sequences F7HT43
ENSCJAP00000043080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]