SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043395 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043395
Domain Number 1 Region: 80-200
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-23
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043395   Gene: ENSCJAG00000012381   Transcript: ENSCJAT00000058767
Sequence length 211
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:75791208:76461876:-1 gene:ENSCJAG00000012381 transcript:ENSCJAT00000058767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSVETLNSTRQGTGAIQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHVLKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWVVLSSRKIEFYKES
KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDSSCPSRNLEIQNPKILQ
Download sequence
Identical sequences F7IM29
ENSCJAP00000043395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]