SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044126 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000044126
Domain Number - Region: 30-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0132
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044126   Gene: ENSCJAG00000003060   Transcript: ENSCJAT00000056699
Sequence length 122
Comment pep:novel chromosome:C_jacchus3.2.1:3:52561771:52613588:-1 gene:ENSCJAG00000003060 transcript:ENSCJAT00000056699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSGKEEEEDSTFTNISLADDIDHSARIFYRRPKSLLPKMMNADMDAVDAENQVELEEK
TRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSK
RK
Download sequence
Identical sequences F7GB77
XP_008990931.1.60252 ENSCJAP00000005548 ENSCJAP00000042169 ENSCJAP00000044126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]