SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044536 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000044536
Domain Number - Region: 10-107
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0196
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044536   Gene: ENSCJAG00000009427   Transcript: ENSCJAT00000055526
Sequence length 252
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:103264592:103307744:1 gene:ENSCJAG00000009427 transcript:ENSCJAT00000055526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFST
FELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELW
RAQIVATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHT
RGSEDLDKDSVEKLELGCPFSPHLPLPTPSVSRSTSRSSANWERLRQGTLRRDLRGIINR
GLEDGEGWEYQI
Download sequence
Identical sequences F7G979
ENSCJAP00000044536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]