SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045294 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045294
Domain Number 1 Region: 142-230
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.73e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 52-138
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000152
Family Elongation factors 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045294   Gene: ENSCJAG00000005800   Transcript: ENSCJAT00000056527
Sequence length 244
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:44961628:44968456:-1 gene:ENSCJAG00000005800 transcript:ENSCJAT00000056527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWRLQEGRGEAVFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYT
VPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLA
LGDFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVV
EKIHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAIAAGEAQA
NMGF
Download sequence
Identical sequences F6Q5N7
ENSCJAP00000045294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]