SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046971 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046971
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily POZ domain 5.49e-22
Family Tetramerization domain of potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046971   Gene: ENSCJAG00000031173   Transcript: ENSCJAT00000058521
Sequence length 223
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:115821461:115827489:-1 gene:ENSCJAG00000031173 transcript:ENSCJAT00000058521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGHEAEEEVLDILRLNVGGCVYTARRESLCRFKDSMLASMFSGRFPLKTDESGACVIDR
DGRLFKYLLDYLHGEVQIPTDEQTRIALQEEADYFGIPYPYSLSDHLANEMETYSLRSNI
ELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKNDGTDAIDKQLGGR
IHSKSIFKREAGNNVQYIWSYYSVAELKKMMDAFDAWEGKGTV
Download sequence
Identical sequences F7I168
ENSCJAP00000046971 ENSCJAP00000046971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]