SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047045 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047045
Domain Number 1 Region: 604-819
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-104
Family Thrombospondin C-terminal domain 0.0000000951
Further Details:      
 
Domain Number 2 Region: 477-602
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.75e-34
Family TSP type-3 repeat 0.00000384
Further Details:      
 
Domain Number 3 Region: 395-479
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.48e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 105-150
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 9.15e-16
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 325-420
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000536
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 6 Region: 196-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000047045
Domain Number - Region: 248-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0036
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 158-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 296-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0549
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047045   Gene: ENSCJAG00000008715   Transcript: ENSCJAT00000052307
Sequence length 836
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:9193955:9206953:-1 gene:ENSCJAG00000008715 transcript:ENSCJAT00000052307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCSFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVSNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGIQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRSGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGFGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVMDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVQLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences F7I900
ENSCJAP00000047045 XP_002760123.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]