SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047416 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047416
Domain Number 1 Region: 1662-1811
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-33
Family Spectrin repeat 0.0000154
Further Details:      
 
Domain Number 2 Region: 425-579
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-32
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 638-790
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-32
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 4 Region: 318-470
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-31
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 5 Region: 758-897
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-29
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 6 Region: 1242-1393
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-29
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 1553-1702
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-29
Family Spectrin repeat 0.0000492
Further Details:      
 
Domain Number 8 Region: 122-260
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-28
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 19-154
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-26
Family Spectrin repeat 0.000000322
Further Details:      
 
Domain Number 10 Region: 1767-1926
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-26
Family Spectrin repeat 0.0000799
Further Details:      
 
Domain Number 11 Region: 1343-1488
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-26
Family Spectrin repeat 0.00022
Further Details:      
 
Domain Number 12 Region: 2038-2150
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-24
Family Spectrin repeat 0.00054
Further Details:      
 
Domain Number 13 Region: 1156-1286
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-21
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 14 Region: 977-1059
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 15 Region: 901-965,1043-1082
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-18
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 16 Region: 1895-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-18
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 17 Region: 2157-2264
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-17
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 18 Region: 2268-2386
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000346
Family Calmodulin-like 0.082
Further Details:      
 
Domain Number 19 Region: 1090-1183
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000389
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047416   Gene: ENSCJAG00000006354   Transcript: ENSCJAT00000061445
Sequence length 2419
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:12247273:12434849:-1 gene:ENSCJAG00000006354 transcript:ENSCJAT00000061445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQFTKETVVESSGPKVLETAEEIQERRQEVLTRYQRFKERVAERGQKLEESYHLQVFKR
DADDLGKWIMEKIKILSDKSYEDPTNIQGKYQKHESFEAEVQAKSRVMSELKKTREERFT
EGHSAHEETKAHIEELRRLWDLLLELTQEKGALLLQALQFQQYMQKCADILEWIGDKEAL
VTSVELGEDWERTEILHKKFEDFQVDLAAREGRVDEVNQYANECAEKNHPELPLIKFKQD
EVNAAWERLHGLALQRQKSLSSAADLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASE
GLFHSHKGLERNLAVMSDKVKELCAKAEKLTVSHPSDAPEIQQMKEDLVSNWEHIRALAT
SRYAKLQATYWWYHRFSSDFDELSGWMKEKTAAINADELPTDVAGGEVLLDRHQQHKHEI
DSYDDRFQSAAETGQALLDASHEASDEVQEKMEILANDWAALLELWDKRHHQYEQCLDFH
LFYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHDDFEEAFTAQEEKITTVDKTA
TKLIDDDHYDSENIAAIRDGLLARRDALRERAATRRRLLKDSLLLQQLYQDSDDLKNWIN
KKKKLADDEDYKDTQNLKSRVQKQKAFEEELADNEILLKNIQKTGQAMIDGDHYASAHVA
TRLSEVDSLWKDLLEATAQKGTQLYEANQQLQFENNAEDLQRWLEEVEWQVTSEDYGKGL
ADVQNRLRKHGLLESAVAARQDQVDTLTELAAYFQEIGHPDSKDIRARQESLVSRCEALK
EPLATRKKKLFDLLQLQLICRDTEDEEAWIQETEPSAASTYLGKDLIASKNLLNRHQVIL
ENIASHEPRIQAITERGEKMIEEGHFAAEDVASRVESLNQNMESLRARAARRQNDLEANV
QFQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNAFGNSMEALR
SQAEACQQQQSAPLEGAAGEQRVMALYDFQARSPREVTMRKGDVLTLLSSINKDWWKVEA
DDHQGFVPAVYVKRLAHDEFPMLPQRRREEPGNITERQEQIENQYRSLLDRAEDRRRRLL
QSYNEFFLAYEAGDMLEWIQEKKAENSGVEIDDVWELQKKFDEFQKDLKTNEPRLRDINK
VADDLLFEGLLTPEGTQIRQDLNARWGSLQRLADEQRQLLGSAYAVEMFHREADDMKEQI
EKKCQALSAADPGSDLFSVQLQRQHKGFERDLTLLGDTVIILGETAERLCESHPDATEDL
QRQRMELNEAWDDLQGRTKDRKENLNEAQKFYLFLSKARELQNWISSIGGMVSSQELAED
LTGTEILLQRHKEHHADMEAEAPSFQALEDFGAELIDSGHRASPEIEKKLQAVRLERDDL
EKAWEQRKKFLDQCLELQMFHGNCDQIESWMVARENSLRSDDKGLLDSLETLMKKRDDLD
KAITAQEGKITDLEHFAERLIADEHYAKEEIATRLQRVLDRWKALKAQLIAERTKFGDYA
DLKQFYRDLEELEAWISEMLPTACDESYKDPTNIQRKYLKHQTFANEVHGRADQVDGVIN
LGNSLIERSACDGNEEVVKEQLKELKEHWDHLLERTDDKGQKLNEASRQQRFNTSIRDFE
FWLSEAETLLAMKDQARDLASAGNLLKKHQLLETEMMAREDALKDLNTLAADLLSSGTFN
VDQITEKRDSVNERFRNVQDLAAAHHEKLKEAYALFQFFQDLDDEESWIQEKLIQVSSQD
YGRDLQGVQNLLKKHKRLEGELVAHEPAIQNVLDMAEELKDKAAVGQEEIQLRLAQFVKH
WEKLKELAKARGLQLEESLEYLQFMQNAEEEEAWINEKNAMAARGDSGDTLAATQSLLKK
HEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAW
KLQLEDDYAFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLEASLQSF
QQERLSEIADLKDQLIAAQHSQSKAIEERYAALLKRWEQLLEASAVHRQKLMEKQLPLQK
AEELFMEFAHKASAFNNWCEKAEENLSEPVHCVSLNEIRRLQKDHEDFLASLAGAQADFK
YLLELDHQIKALGVPSSPYTWLTVEVLERIWKHLSDIIKEREQELQKEEARQVKNFEMCQ
EFEQNASAFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIEDLG
DNLEDALILDIKYSTIGLAQQWDQLYQLGLRMQHNLEQQIQAKDTIGVSEDTLKEFSTIY
KHFDENLTGRLTHKEFRSCLRGLNYYLPMVEEGEPEPKFEKFLDAVDPGRKGYVSLEDYT
SFLIDKESENIKSSDEIENAFQALAEGKAYITKEDMKQALTPEQVSFCATHMQQYMDPRG
RSHHSGYDYVGFTNSYFGN
Download sequence
Identical sequences F7IMR9
ENSCJAP00000047416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]