SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047745 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047745
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000615
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 69-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 105-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047745   Gene: ENSCJAG00000011017   Transcript: ENSCJAT00000060350
Sequence length 155
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:99195980:99495500:1 gene:ENSCJAG00000011017 transcript:ENSCJAT00000060350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD
EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCKNGLCIDKSFICDG
QNNCQDNSDEESCESSQGLHGTTFLHHPTLLTRSL
Download sequence
Identical sequences F7EG44
ENSCJAP00000047745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]