SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049577 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049577
Domain Number 1 Region: 344-611
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-42
Family Kelch motif 0.0071
Further Details:      
 
Domain Number 2 Region: 703-872
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-26
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 86-208
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1009-1055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000049577
Domain Number - Region: 56-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0265
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049577   Gene: ENSCJAG00000019375   Transcript: ENSCJAT00000061704
Sequence length 1374
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:102806389:103657637:1 gene:ENSCJAG00000019375 transcript:ENSCJAT00000061704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGGQAHTGPPQPAAPGLRARPAGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQSKPCE
RTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIE
GYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVVTTS
GYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSISVPSQVYCECDKYWGEACD
IPYCKANCGSPDHGYCDLTGKKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGR
ASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTLSRGPLQRYGHSLALYQE
NIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMELDSRD
VVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHG
GYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTS
LSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLN
DILVYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNILRAKCPPKTAASDD
RCYRYADCASCTANTNGCQWCDDKKCISTNSNCSMSVKNYTKCHVRNEQICNKLTSCKSC
SLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRINSSRENYDNAKLYCYNLSGNLAS
LTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSG
FCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGME
CMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPS
NTGRGHCIEGSSRGPMKLIGMHHNEMVLDTNLCPKEKNYEWSFIQCPACQCNGHSTCINN
NVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHLHTGKCFCTTKGIKG
DQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSNKNLD
ISINASNNFNLNITWSVGSTAGTISGEETPIVSKNNIKEYRDSFSYEKFNFRSNPNITFY
VYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRRE
QLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVLTVFLC
LPRGSSGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV
Download sequence
Identical sequences F6UTX3
ENSCJAP00000042534 ENSCJAP00000049577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]