SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050093 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050093
Domain Number 1 Region: 635-821
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-53
Family DBL homology domain (DH-domain) 0.000000173
Further Details:      
 
Domain Number 2 Region: 829-956
Classification Level Classification E-value
Superfamily PH domain-like 5.73e-35
Family Pleckstrin-homology domain (PH domain) 0.000014
Further Details:      
 
Domain Number 3 Region: 323-464
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000173
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 130-229
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000405
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050093   Gene: ENSCJAG00000010156   Transcript: ENSCJAT00000057918
Sequence length 1003
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:127341135:127453892:-1 gene:ENSCJAG00000010156 transcript:ENSCJAT00000057918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQAAASAPCTPLSWIPGLPQNPGGCTCMPTTQAIPLQVDMAMALQRVRIAEKYGKNYLC
LLQAVFVAETNLLFRIKDISHFLMQDIAFLSGGRGKDDAWIITFPENCNFRCIPEEVIAK
VLTYLTSIARQNGPDSRFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSFLQ
RTFTDIGFRFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNA
IENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGK
ILLTNLEVPDTEGAVSSRLECHQQISGDWQTINKLLTQVHDMETAFDGFWEKHQLKMEQY
LQLWKFEQDFQELVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLAKAQF
VILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKIHKLLQQARQC
CDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPELK
VQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPVQFVVPTSENLIRSRAPFFSSKHGKK
TWRQNQSNLKIEVVHDCPEKRSSGPSSSLDNSNSLDVLKNHVLNELIQTERVYVRELFTV
LLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGLC
FLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITK
YQLLLKELLKYSKDCEGSAQLKEALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQ
GGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHC
WKMDEVGITEFVKGDNRKFEIWYGEKEEVYIVQAPNVDVKMTWLKEIRNILLKQQELSTV
KKRKQQDQLAEQDKIQISLQQNDEDPCRRWLSYFDEATMSNGK
Download sequence
Identical sequences F7F081
ENSCJAP00000050093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]