SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051634 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051634
Domain Number 1 Region: 80-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051634   Gene: ENSCJAG00000019358   Transcript: ENSCJAT00000057117
Sequence length 216
Comment pep:novel chromosome:C_jacchus3.2.1:14:36024881:36040263:1 gene:ENSCJAG00000019358 transcript:ENSCJAT00000057117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAPGTLDLRAATPALLGVPQAEVLEEVLREEFGPLPQLAAICRLKRLPSGGYSSTEDL
QLVLERRRARRLWKQPPSIKNLNRGFAKLKALVPFLPQSRKPSKVDILKGATEYIQVLSH
VLEEAEDSEKQDPDEQSYSSSTSEPHISSTRELSRNIIQGISCAFSLKNEEEEPWADGGS
GEPTHSCRQRVLSTTGVMSPTRSLDRFPEVELLSHR
Download sequence
Identical sequences F6ZZ60
ENSCJAP00000051634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]