SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.004460.2|PACid:16951009 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.004460.2|PACid:16951009
Domain Number 1 Region: 68-158
Classification Level Classification E-value
Superfamily BRCT domain 1.45e-23
Family DNA-repair protein XRCC1 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.004460.2|PACid:16951009
Sequence length 372
Sequence
MSNSKANEGGGSAKRSLPSWMSGKDDGSTSRGKKPNSSASVGNDLMVEAEEPKQEKGNGE
GPVSSSLHHDFSRLLEGVVFVLSGFVNPERSILRSQALEMGAQYKPDWNSDCTLLICAFP
NTPKFRQVESDCGTIVSKEWISECYAQKRLVDIESYLLYAGKPWRRCDLSREATQDIPSP
SKKPQRVVEKTSHLKPHEPEIAQSRRSNFSRDCFSPSKLKKWAIDDYHKTLSWLESQEEK
PDPSEIKKIAAEGILTCLQDAIDSLHQNQDINQMTEEWKFVPQVVEELAKLSNKKESISK
EELCRQATDSKSIYEVELNSLLESSPERKKKRIVKKESKNGHETKEYDSDDTIEMTEEEI
DVAFHKVVCKNS
Download sequence
Identical sequences A0A0A0KAC1
Cucsa.004460.1|PACid:16951008 Cucsa.004460.2|PACid:16951009 XP_004135823.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]