SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.031510.2|PACid:16952311 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.031510.2|PACid:16952311
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily BRCT domain 3.63e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.022
Further Details:      
 
Domain Number 2 Region: 361-415
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000236
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 454-502
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000408
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.031510.2|PACid:16952311
Sequence length 512
Sequence
MESVVVTVSGYHGTERFNLIKMISYTGASYVGAMSRSITHLICWELQGRKFDLAEKFRTI
IVNHRWLEDCIKHGKRVPEGPYILQSGQSIGPLSMKLPLADKGYVSAKKYNLLSEKLHNY
GNVEDQSIKDICSFGDSILPRSSLLDKDLSSDFRKSDDTAHKRKHKVRKRISKLEDPSSS
SSRNRFEEPTSAGLFAIECGSPSSLARDERKGESSNQDSTVKSSRRRRLLVSNNSREDHN
KPDISNFDPELYRLGTRNSLTVPSVLWDAETDIEVVNIGGTSDREQLCDERGLASVRFEG
VEACENQSTSKDTNLLVDNAPRVLSITSEDELHNMNDLQKNIEDPVIELDASLPSTSTEL
SCVICWTDFSSTRGVLPCGHRFCYSCIQNWADHMALSRKISTCPLCKASFLSITKVEDAA
TSDQKIYSQTIPCGSSLLDIYLLSDERTLNNVVQPSVAAVCSACRCREPEDLLMSCHLCQ
IRQIHSYCLDPPLLPWTCIHCKDLQTLYHRSH
Download sequence
Identical sequences Cucsa.031510.2|PACid:16952311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]