SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.037120.1|PACid:16952697 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.037120.1|PACid:16952697
Domain Number 1 Region: 458-545
Classification Level Classification E-value
Superfamily BRCT domain 3.93e-26
Family BRCT domain 0.0019
Further Details:      
 
Domain Number 2 Region: 27-90
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000707
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Domain Number 3 Region: 569-676
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000414
Family BRCT domain 0.043
Further Details:      
 
Weak hits

Sequence:  Cucsa.037120.1|PACid:16952697
Domain Number - Region: 335-399
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0068
Family C1-like domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.037120.1|PACid:16952697
Sequence length 679
Sequence
MSGFSTSANTTRFLNPWLLHFQKMGLELKCPLCLNFFDDPILLPCNHLFCKSCMPFAAQI
GSVCPLCKAGFVDRDMRPAPFMDKMVSIYRSLDATFSTNMSKLVSTVDVGAAVEQSRFGQ
SVSYVANNCKEFEGCSMPVDSKRQHLGIEGRKGEHGRHEDCVMPPVSQTDQLSSGSPPSF
GDGKVSDDSSDEYRGHGSKNTSDWISVITSADDKKLQLSKCTSSASEEEGHLRDLKRQKL
NYGQLKFRISSADQTHPPVSEPGNSETSNSGMEHKSQVTNASSMPLADADDTIVRNVKCA
FCQSSKVTEDTGAVLHYMNGRLVDGVEAASPNVIHVHKLCVEWAPQAYFQGDDVHNLKAE
VARGSKLKCSKCGLKGAALGCYLRSCQKSYHVPCALEIDECRWDMDNFLVLCPSHTSARF
PDERSKPRKMPRDQASLFQMNQKDLSNWASASDGVNKWTFCGSALSAEERNILVKFAKLT
GATVSKLWKPDVTHVIASTDENGACTRTYKVLMGILNGIWILNMDWVKDCMKEKCPLNEE
AYEIALDNYGCTDGPKTGRLRVLNKEPKLFIGLSFYFTGDFPPAYEEDLQDLVITAGGTV
LEDEELAATSSNDQAAPKVVVVYNLDSPGGCKVGEEVSILWQRMNEAEGIAAKVGAQVIG
HTWLVESIAMGSLQPFVSC
Download sequence
Identical sequences Cucsa.037120.1|PACid:16952697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]