SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.048110.2|PACid:16953796 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.048110.2|PACid:16953796
Domain Number 1 Region: 267-370
Classification Level Classification E-value
Superfamily BRCT domain 6.83e-21
Family BRCT domain 0.0032
Further Details:      
 
Domain Number 2 Region: 376-488
Classification Level Classification E-value
Superfamily BRCT domain 0.00000155
Family DNA-repair protein XRCC1 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.048110.2|PACid:16953796
Sequence length 490
Sequence
MDSVDNILQKNPSINQNQHDNCAIPGLTTTLSAIATSTGLKREHKKQIEYNNITQEKYDG
AQANRSQLSEKLQSTNGKNLDSMTKNDCSEKHERLDDEFQCAFCRSSEESEGSGRMVHYF
NGKPIDNDIKNSKVIHAHWNCVEWAPNVYFDGDTAINLEAELSRSRRIKCGCCGNKGAAL
GCYDKNCRKSFHVPCAKLMPQCQWDTENFVMLCPLHPDSKLPSQDPGHQERKSSCASNRQ
SNTKCIAVAREISKHGRFTFRESSKKLVLCCSALTIAEREAVDEFQRLSGVPVLQKWDDT
VTHIIASTDENGACKRTLKILMGILKGKWILGIEWIKACIQAMEQIKEERFEITLDVHGS
RDGPQLGRLRVLNNQPKLFAGFKFFFTADFAPSYKGYLQQLVTAAGGNILHRKPVSSNNQ
NVSSSSPNCQVFIIYSLELPDQCNPGEKNNILHRRRSDAELLAKSAAAKVATNLWLLNSI
AGSKLTSLEE
Download sequence
Identical sequences Cucsa.048110.2|PACid:16953796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]