SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.053430.2|PACid:16954313 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.053430.2|PACid:16954313
Domain Number 1 Region: 764-979
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.63e-69
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.000000341
Further Details:      
 
Domain Number 2 Region: 488-613
Classification Level Classification E-value
Superfamily WGR domain-like 3.14e-34
Family WGR domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 632-765
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 4.05e-33
Family Domain of poly(ADP-ribose) polymerase 0.0000846
Further Details:      
 
Domain Number 4 Region: 5-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.28e-26
Family PARP-type zinc finger 0.0047
Further Details:      
 
Domain Number 5 Region: 100-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-20
Family PARP-type zinc finger 0.0087
Further Details:      
 
Domain Number 6 Region: 391-479
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000353
Family DNA-repair protein XRCC1 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.053430.2|PACid:16954313
Sequence length 980
Sequence
MAEPQKPWKVEYAKSSRSSCKTCKSPIQKENLRFGKMVQATQFDGFMPMWNHAACILKKA
KQIKSIDDVEGLDSLRWEDQLKIRQYVEDSVAAAAVVVTPIEYGIEVSQTSRASCKHCKQ
KIMKGEVRLSTVLDGKGTKGLAWYHANCYMEQCPSAQVEKLAGWQNLPPSDQAAISTLVK
KPSSAVKNEEKQTTSKAGKRKKDTAEDQDSKVTKATGDVSESRSMKNAIVSADSQNSADL
VSKLEAQSKGLWKLKDDLKKHVTTSELREMLESNDQDSTGSELDLRDRCADGMMFGALAK
CPICFGSLCYSRGMYRCHGYQSAWSKCSYSTCEPERLRGKWKVPEETGNLYLSKWFKSQK
GAKPIRLLPPPTSSTTNSNQTSNGQSQSSNSENLAELRVSFYGLKDSMGEWKRKIEGEGG
AVHAKIKKDTNCLVVSGYVDEYNPEMKKARRMKIPIVREEYLVDCFRKQKKLPYDRYKVE
ATSESTSLVTVKVKGRSAVHESSGLQDTGHILEDKKSIYNTTLNMSDLLTGINSYYILQI
IQDDKSSDCYVFRKWGRVGNEKIGGVKLEEMTKSDAIREFKRLFLEKTGNPWEAWEQKLN
FEKQPGRFFPLDIDYGVNKDMPKKPKNYPATKLAPQLAELMKMLFNVETYRAAMMEFEIN
MSEMPLGKLSRSNIQKGFEALTEIQNLLNSSVHDPYMKESLIIDASNRFFTVIPSIHPHI
IRDEDDFKSKLKMLEALQDIEIASRLVGFDGDSHESLDDKYKKLHCDIAPISHESEDYKL
IEKYLLNTHAPTHTDWALELEEVFSLEREGEFDKFVPFRQKLKNKMLLWHGSRLTNFVGI
LSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDRNNPIGFMILSEVALGEVYEL
KKAEYMEKPPRGKHSTKGLGKKVPAALEHVKWKEDVVVPCGKPVASNVKASELMYNEYIV
YDTAQVKMQFLLKVRFHHKR
Download sequence
Identical sequences A0A0A0L7J5
Cucsa.053430.2|PACid:16954313 XP_004151977.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]