SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.055940.1|PACid:16954471 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.055940.1|PACid:16954471
Domain Number 1 Region: 54-145
Classification Level Classification E-value
Superfamily BRCT domain 3.79e-21
Family DNA ligase 0.026
Further Details:      
 
Domain Number 2 Region: 204-279
Classification Level Classification E-value
Superfamily BRCT domain 0.0000759
Family BRCT domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.055940.1|PACid:16954471
Sequence length 544
Sequence
MGGGTVEVVSSKGCSRLLFGFSSPLSSLGGLQQLESMSLASPSSRSEPVKVRLAGPFTGL
VICVTGLSKEARKQVKEATERLGGQYSPNLHPQCTHLVVQSLGGRKFEHAFKHGSRNGLF
VVSLGWFVDSVRRNVRLSESLYTIKSLGENSGRLDELKHLAGSGGDGNSCLPVGIHGVEQ
NDTIGDSQLSFSKKDRDRRMDSNLSGQSMYIDTDISPELRHKVIEAAKGVGASLVDHWFA
GCSTNHVVCERTSIHRYLGQSSNLVTPLWILKTVTEKRAQRLIHMSADLARQISSTLEDL
CAENFTEAKNRQQEDTRTSRSKTTQAEREQTISNAKLGVRKRRACRMQTCQNPIRPLTPS
SLLDSICWSISEPSSSASIYTDSFSSEGVSEHHTPEFFDATGDGKESEASFSNLTRPLSE
SEKSEVVFKNHYLTILFPVDRFFEMGPSSRTYFSYKGFTCFQILDHIYTFYQENMSDHEI
EMAIHTDSRHADRLRSVYCSRETTESGCVVFKRIEFLGSRRSFEMLKRVSVDNNSNVYEL
LIRA
Download sequence
Identical sequences A0A0A0KFI3
Cucsa.055940.1|PACid:16954471 XP_011657361.1.97903 XP_011657362.1.97903 XP_011657363.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]