SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.055940.2|PACid:16954472 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.055940.2|PACid:16954472
Domain Number 1 Region: 54-144
Classification Level Classification E-value
Superfamily BRCT domain 8.64e-19
Family DNA ligase 0.021
Further Details:      
 
Domain Number 2 Region: 203-278
Classification Level Classification E-value
Superfamily BRCT domain 0.0000759
Family BRCT domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.055940.2|PACid:16954472
Sequence length 543
Sequence
MGGGTVEVVSSKGCSRLLFGFSSPLSSLGGLQQLESMSLASPSSRSEPVKVRLAGPFTGL
VICVTGLSKARKQVKEATERLGGQYSPNLHPQCTHLVVQSLGGRKFEHAFKHGSRNGLFV
VSLGWFVDSVRRNVRLSESLYTIKSLGENSGRLDELKHLAGSGGDGNSCLPVGIHGVEQN
DTIGDSQLSFSKKDRDRRMDSNLSGQSMYIDTDISPELRHKVIEAAKGVGASLVDHWFAG
CSTNHVVCERTSIHRYLGQSSNLVTPLWILKTVTEKRAQRLIHMSADLARQISSTLEDLC
AENFTEAKNRQQEDTRTSRSKTTQAEREQTISNAKLGVRKRRACRMQTCQNPIRPLTPSS
LLDSICWSISEPSSSASIYTDSFSSEGVSEHHTPEFFDATGDGKESEASFSNLTRPLSES
EKSEVVFKNHYLTILFPVDRFFEMGPSSRTYFSYKGFTCFQILDHIYTFYQENMSDHEIE
MAIHTDSRHADRLRSVYCSRETTESGCVVFKRIEFLGSRRSFEMLKRVSVDNNSNVYELL
IRA
Download sequence
Identical sequences Cucsa.055940.2|PACid:16954472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]