SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.055940.3|PACid:16954473 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.055940.3|PACid:16954473
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000484
Family DNA ligase 0.035
Further Details:      
 
Domain Number 2 Region: 139-214
Classification Level Classification E-value
Superfamily BRCT domain 0.0000698
Family BRCT domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.055940.3|PACid:16954473
Sequence length 479
Sequence
MFLAEARKQVKEATERLGGQYSPNLHPQCTHLVVQSLGGRKFEHAFKHGSRNGLFVVSLG
WFVDSVRRNVRLSESLYTIKSLGENSGRLDELKHLAGSGGDGNSCLPVGIHGVEQNDTIG
DSQLSFSKKDRDRRMDSNLSGQSMYIDTDISPELRHKVIEAAKGVGASLVDHWFAGCSTN
HVVCERTSIHRYLGQSSNLVTPLWILKTVTEKRAQRLIHMSADLARQISSTLEDLCAENF
TEAKNRQQEDTRTSRSKTTQAEREQTISNAKLGVRKRRACRMQTCQNPIRPLTPSSLLDS
ICWSISEPSSSASIYTDSFSSEGVSEHHTPEFFDATGDGKESEASFSNLTRPLSESEKSE
VVFKNHYLTILFPVDRFFEMGPSSRTYFSYKGFTCFQILDHIYTFYQENMSDHEIEMAIH
TDSRHADRLRSVYCSRETTESGCVVFKRIEFLGSRRSFEMLKRVSVDNNSNVYELLIRA
Download sequence
Identical sequences Cucsa.055940.3|PACid:16954473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]