SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.076260.1|PACid:16955835 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.076260.1|PACid:16955835
Domain Number 1 Region: 646-745
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000236
Family DNA topoisomerase II binding protein 1, TopBP1 0.091
Further Details:      
 
Domain Number 2 Region: 767-861
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000654
Family 53BP1 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.076260.1|PACid:16955835
Sequence length 876
Sequence
MYPQDSGCNRFHLFLSGQDSIPENVAPSSNNALHFHLHLSSYGGSECTSSQHLDESHQLL
EYSKVQLISMFEAPVDPREHIPSQKSINAGDTDLAPHSSYKDVLHNVGCQSLTNTEDREN
RQGEKLDVGCLKNAEVSDAIELSVVASEALVIHELLKDELDSAAVSVEAVLEASIQVKKA
RIELLESALESIDEEVDLSDSLSDLDNSTMRDAFDDVGLPSSILNSDHSGTACFDVQDTP
VNKNEFTHGSQCNSIDMTSQPDILGNGLTLKQLEENLVVTRPVGLPMEDLSCNIQHQLSN
DDVLGSTSTNYCKYDSMLQHPTQNESDEFVVKQEVDVSEQLRQDVDGKTIPLMFVNETSF
LSESADIAPDENSCVQRCESKFQVASQSSIHFGHLDEKGDDGLLVAEEIVKCSLSLVDPL
CSFVPCSISLDTDSAGQNLNEGKDCTEELLGTFVDVGGSRPSIRRQVTSLKNYSTISPTH
ATMEGGLDNSYAHQLPGNMRLLSSDSQLDCTRFSSKINFMETLPSQSTKSRDMDTVEDSQ
TDARHNLVEEITELKSKSDEVAGDVSEFLADTVKKSVTCDILNGSLQLSKSTMKKSSIKK
DHLQSSKTISNPQKVDNVVKMQHESKNPLEPCHLKSRYCSSRKKLIFQGIQFLVTGFSSR
KEKDINGIVCNNGGIILPDIPCPSSRGQKMSKSDCKGPPVILSSKKLQTKKFLYGCAVNS
LIVNVSWLTDSIAAGSIVPPWKYMIISNQADCTQIGRSVRHSSRRYIFENVGVMLHGKQG
FCTKLTNVLKHGGGQVFKTLQWLVKSLNQEKISVGVIVVEDEHKSSRHLKQCALEQGIPL
MSTKWVIKSLHLGELLPLTENNRSSLVQTTKMSKDI
Download sequence
Identical sequences Cucsa.076260.1|PACid:16955835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]