SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.084680.1|PACid:16956579 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.084680.1|PACid:16956579
Domain Number 1 Region: 640-737
Classification Level Classification E-value
Superfamily BRCT domain 8.87e-21
Family 53BP1 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.084680.1|PACid:16956579
Sequence length 846
Sequence
MVSKLGNDDSGGSFDDFELLQNTLSFEDSVGFDNRVVRLESPFVDTEMVYGLDDCSENLC
IPTFEYEDDVVLDSEDEGINGSRVIRVSSSLSRNEAEQEVKSDAQEENMVLDFHSSDHKP
CDAGEQVSSNCFNGLDMEKDSSQLSTRLSYCSSQEPGESTQVKAIGFVDHFVKLSTTNVN
PSQGIGQRKAARVQSPNLSRIKGPQSLAKRIGRKSIDETGNFEWVDINNQEAECNSFGKC
KKASSDLSNCRGQSYTTKPHNMAKLSNIRDCLLKRYEDKEEASAGIKFQTDSTASTFPHP
RLDIYSLETDGMSSIEIENRSNEKTNAKLVEGQLEFMDDERDAPDELDIGFSTQIAAEAM
EALCYIPDNDTLANACSSENALDSVSCSMIEHKPHLNSSYPQTIGGADGKSKRTLKSKRK
LNAKCLNTSKVQCECQELQAVLITKSKAKRSWLALQGQSNYRKSPDESNYTATPSNLLSE
TGSCQLSQRGLTIGDQVSTRLMVGLCSHPRGRRTPRNIQSHPNRSKNQNNTSLAVDESCN
NSILMKNGKVGRNSNSKSTVVIRRMFYMGFVQSRFSNILCFTVGKNTSRSRSKFKVYHNT
SRRIMLPQSSSKELARLGVSESMPDLKWKDLRRRRTMALVRVCFSQHLDEVTLKQQKRVV
LQLGISIASSSVDATHFVADKFVRTRNMLEAIALGKPVVTHSWLESCGQASCFIDEKKYI
LRDTKKEKEIGFSLPVSLSRATQCPLLQGFKVLVTQNIRPGKEIIASLVKMSQGEPIEMS
QIFTGKNEKFPNNLLILSCEEDYADCVHFLKKGAKVYSSELLLNGIVIQKLENKRHELFT
DSTKRF
Download sequence
Identical sequences Cucsa.084680.1|PACid:16956579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]