SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.086670.2|PACid:16956791 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.086670.2|PACid:16956791
Domain Number 1 Region: 610-755
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 6.97e-41
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 350-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-37
Family Extended AAA-ATPase domain 0.0000396
Further Details:      
 
Domain Number 3 Region: 214-293
Classification Level Classification E-value
Superfamily BRCT domain 6.83e-18
Family DNA ligase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.086670.2|PACid:16956791
Sequence length 968
Sequence
MGDIRKWFMKAHDKDNGSGSKKAKPAPSSLEKSASAGKTGPSGGESAGRQITSKYFASEK
QEAKDAEETEVLPIIRKSPRDTKESPAKRKFQKYNEESPKASPLKKSNKVDDNDDDAVLS
SSKKNMSEVTPNKKLKSGSGKGITQKPVEIEASDDEETKGTDSSLKPSGRGRGGKGSSAA
TIGGRGRGGGRGGFMNFGERKDPPHKGEKEVPEGAPDCLAGLTFVISGTLDSLEREEAED
LIKRHGGRVTGSVSKKTNYLLCDEDIGGRKSSKAKELGTGFLTEDGLFDMIRASGKKAPP
RQDPKKSVVKSEESPTKKNFQKVQAKSHKDLAAGASPAKQKSGTAEFSNLTWTEKYRPKV
PNDIIGNQSLVKQLHDWLAHWNENFLDVGSKKKVKKASDSGAKKAVLLCGGPGIGKTTSA
KLVSQMLGFEAIEVNASDNRGKSDAKIQKGIGGSNANSIKELISNESLHFKMNQPKHHKT
VLIMDEVDGMSAGDRGGVADLIASIKMSKIPIICICNDRYSQKLKSLVNYCLILSFRKPT
KQQMAKRLVQVANAEGLQVNEIALEELAERVNGDMRMALNQLQYLSLSMSVIKYDDIRQR
LLSSKKDEDISPFTAVDKLFGFNSGKLRMDERIDLSMSDLDLVPLLIQENYINYRPSAVS
KDDTGIKRMDLIARAAESIADGDIINVQIRRHRQWQLSQSSCVASCIIPASLLHGQRETL
EQYERNFNRFGAWLGKNSTFGKNMRLLEDLHVHILASRESCSGREHLRVENLTLFLKRLT
EPLHTLPKDEAVKTVVEFMSLYSISQEDFDTVLELSKFQGRKNPLDGVAPAVKAALTKAY
KEASKTHMVRAADLIALPGMKKAPKKRIAAILEPTEDTVEGAGGETLVESDDENSVDNEG
EENSTNGQKLQLELQSLNKKGMQVQLDLKGVEDSSAKKSGGRGKGGRTSQASEKKGGRGS
GSATKRKR
Download sequence
Identical sequences A0A0A0KEG6
Cucsa.086670.1|PACid:16956790 Cucsa.086670.2|PACid:16956791 XP_011657597.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]