SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.106950.1|PACid:16959537 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.106950.1|PACid:16959537
Domain Number 1 Region: 76-232
Classification Level Classification E-value
Superfamily IpsF-like 2.62e-58
Family IpsF-like 0.00000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.106950.1|PACid:16959537
Sequence length 233
Sequence
MALSAPLFASPAAATTSHQSLSLSLYPPSFPTTKFTPLSSFSSSSSLPSFRVNSAASHSV
SSTTAIKSDSPSKTLPFRVGHGFDLHRLEPGYPLIIGGISIPHDRGCEAHSDGDVLLHCV
VDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMHEAGYDIGNLDATLILQRPK
LSPHKEAIRAKLSELLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRR
Download sequence
Identical sequences A0A0A0KWV1
Cucsa.106950.1|PACid:16959537 XP_004146533.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]