SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.106950.2|PACid:16959538 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.106950.2|PACid:16959538
Domain Number 1 Region: 76-231
Classification Level Classification E-value
Superfamily IpsF-like 7.59e-55
Family IpsF-like 0.00000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.106950.2|PACid:16959538
Sequence length 232
Sequence
MALSAPLFASPAAATTSHQSLSLSLYPPSFPTTKFTPLSSFSSSSSLPSFRVNSAASHSV
SSTTAIKSDSPSKTLPFRVGHGFDLHRLEPGYPLIIGGISIPHDRGCEAHSDDVLLHCVV
DAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMHEAGYDIGNLDATLILQRPKL
SPHKEAIRAKLSELLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRR
Download sequence
Identical sequences Cucsa.106950.2|PACid:16959538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]