SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.141590.1|PACid:16963502 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Cucsa.141590.1|PACid:16963502
Domain Number - Region: 6-41
Classification Level Classification E-value
Superfamily WWE domain 0.0298
Family WWE domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.141590.1|PACid:16963502
Sequence length 58
Sequence
MTEKYCLVIEKENNLSNQMRNITMFVINHLYTISFQTRMKKFVSSLCYKMKAKQLHKD
Download sequence
Identical sequences Cucsa.141590.1|PACid:16963502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]