SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.180490.1|PACid:16967317 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.180490.1|PACid:16967317
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.12e-39
Family Type II thymidine kinase 0.00015
Further Details:      
 
Domain Number 2 Region: 217-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000475
Family Type II thymidine kinase zinc finger 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.180490.1|PACid:16967317
Sequence length 281
Sequence
MKSFVSSSSFSILSPYFPISASPSFFSLPSKSAQCGPMFTQLSNFFTFKTPTISLPSKGF
FSTQNRNPQMRASLSPPSGEIHVILGPMFAGKTTTLLRRIQSESCNGRSVAIIKSNKDTR
YGLDSIVTHDGMKLPCWAIPNLSSFKKKFGQGSYDKLDVIGIDEAQFFDDLYDFCCEAAD
IDGKTVIVAGLDGDYLRRNFGSVLDIIPLADSVTKLTARCEICGNRAFFTLRKTQEKETE
LIGGADMYMPVCRQHYVSGQVAIETARTVVESRKVGYRTPA
Download sequence
Identical sequences Cucsa.180490.1|PACid:16967317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]