SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.200440.1|PACid:16968786 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.200440.1|PACid:16968786
Domain Number 1 Region: 342-432
Classification Level Classification E-value
Superfamily BRCT domain 2.91e-16
Family DNA-repair protein XRCC1 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.200440.1|PACid:16968786
Sequence length 608
Sequence
MVNKVTRKKHYRPPGQKKEGNAARYVTRSQAVKQLQIGLPLFRKLCIYKGVFPREPKKKV
KGNHHTYYHLKDISFLHHEPLLEKCREIRAYEKKIKKADAKKNKERANFLIERRPTYLSG
LLRIIKERYPKFIDALRDLDDCLSLVHLFAALPAQERLKVEAKRIHECRRLSHEWQAFIS
RTHKLRKVFISVKGIYYQAEVEGQKITWLAPHALHQILTDDVDLTVILNFMDFYEKLLAH
VNKHLFNSINLEYPPILDPRLEALAADFYALLRFFDANTRTSLLNPQTSSSSQFGQVDAE
DSELRLAQLQHQLPLNEPTALMHLVEDASGMDEDEDEDTRECKKLFKNMKFFLSREVHRE
SLLFIIPAFGGMVSWEGDGAPFKESEKTITHQIVDRSTQTHKFLSRDYVQPQWVFDCVNN
RIILPTEDYLVGRDPPPHLSPFVDNDAEGYVPDYAVTLNKLKADAKNEILPLPGVGKEDL
DDPQKLLDAGVIDRAKAIEAAEMKQKMMALEKEYHDELKLELQGGNYSSAISNVDKQLPD
QEKEGGEDTNLPDYQQMAEDTDKLSKVMMSRKKKSLYEAMQIGKRTKKGKIDLLHERKKK
HKESHKSQ
Download sequence
Identical sequences Cucsa.200440.1|PACid:16968786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]