SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.205120.1|PACid:16969057 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.205120.1|PACid:16969057
Domain Number 1 Region: 110-195
Classification Level Classification E-value
Superfamily BRCT domain 5.09e-18
Family DNA ligase 0.026
Further Details:      
 
Domain Number 2 Region: 1055-1140
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000393
Family BRCT domain 0.014
Further Details:      
 
Domain Number 3 Region: 1286-1356
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000104
Family PHD domain 0.0082
Further Details:      
 
Domain Number 4 Region: 9-87
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000974
Family DNA topoisomerase II binding protein 1, TopBP1 0.038
Further Details:      
 
Weak hits

Sequence:  Cucsa.205120.1|PACid:16969057
Domain Number - Region: 1168-1248
Classification Level Classification E-value
Superfamily BRCT domain 0.0157
Family DNA topoisomerase II binding protein 1, TopBP1 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.205120.1|PACid:16969057
Sequence length 1372
Sequence
MEIDYSRQPFLGVHFVLFGFNIVDEKQVRSKLIDGGGVDVGQYGPSCSHVIVDKNKIVYD
DPVCVAARNDGKLLVTGLWVDHRYDSGLLADATSVLYRPLRELNGIPGAKSLVMCLTGYQ
RQDRDDVMTMVGLIGAQFSKPLVANKVTHLICYKFEGDKYELAKRLRTIKLVNHRWLEDS
LREWMLLPESNYNISGYDMEMLEAEAKDSEEESNSGITKHFAMRNTKSPDKMKFGLHSTS
VISNTVPASKTLDERTSFSDTKSMLTVPTTNTEFIPSGKFDKYDEVRGPICQEVDVFSTP
WDSVPFNMHTTTSESEKQKVKNEAVTSPSNAARSPQLCATSYSRRTPLKSPLPLFSGERL
ERADASCKIATGEIKDAIGVDVSLEKMEQVTYATFSGHEQNSSKGTDLFGTGDSNAGLPL
KKNSDVSYDVPRSHSMSENTKSCTLNNPSTDEKVLGLEMSRVSLNHDDSDKRRAKTLQHS
RGSTDTSSPIKKPLICDLPFGNSVRSPTEDVAGGSLKTPRTPFQISGKDLSPDKPNKPIH
DCEISGDLVGKTKETDRQQNGVLAAPESDSGTKVTKTKSASPSSLNSSVLQNNNLQSKPQ
RIKMFAKKSLGSRPKLGSGSHRGSILSSKTTSLNDSVSLSCGNGEKLFSSSPQDVSIGVK
KVVKTADKGDFSHKYEVMDEDDKTSDPENKEDFEHRMMDTENFKEVPQISDGEKVAKEIA
SGVKCNSSASVLNDTIPSGTLKEVIERKAPLSIGNVQLDELRLEDEKSKLNVGDRGPTEE
KMLINSSKAKSKQGKVCKAPAREKNGKTGKKPQLVAAGLNTEVHTIHDYISEKVNVPCEA
MDEDDKTFDVENKEADFEQQMMDMENFNGVPLMIDDDKLEKEIASGVKCNNSSRVLDDTI
PSGTLEEVIEPKAPVSIGNVQLDELSLEDEQSKLNVGDRSPTEEKMLKNSKEKSKQGKVC
KAPSRKKNVKTGKKPQLVAAGLNTEVHTIPDHKSEKENVPCDVGDKNSHIVKHFDKITVK
SNTKQRKVTKKSSEISANSSMEIEEVLSEVKPEPMCFILSGHRLERKEFQKVIKHLRGRV
CRDSHQWSYQATHFIAPDPVRRTEKFFSAAASGRWILKSDYLTDSSQAGKLLDVEPYEWY
KKGLTEDGAINLEAPRKWRLLREKTGHGAFYGMRIIIYGECIAPPLDTLKRAVKAGDGTI
LATSPPYTKFLKSGVDFAVVGPGMPRADTWVQEFLNNEIPCVAADYLVEYVCKPGYPLDK
HVLYNTHAWAERSFSNLQSKAEEVAEDLSSQDDCSDNDIACQECGSRDRGEVMLICGNED
GSSGCGIGMHTDCCNPPLLDIPEGDWFCSDCINSRNSNSSNKRKKGVSVKRK
Download sequence
Identical sequences Cucsa.205120.1|PACid:16969057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]