SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.205510.2|PACid:16969112 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.205510.2|PACid:16969112
Domain Number 1 Region: 341-556
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.27e-73
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 207-339
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 1.03e-38
Family Domain of poly(ADP-ribose) polymerase 0.0000818
Further Details:      
 
Domain Number 3 Region: 57-181
Classification Level Classification E-value
Superfamily WGR domain-like 1.7e-38
Family WGR domain 0.00037
Further Details:      
 
Weak hits

Sequence:  Cucsa.205510.2|PACid:16969112
Domain Number - Region: 1-34
Classification Level Classification E-value
Superfamily SAP domain 0.000366
Family SAP domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.205510.2|PACid:16969112
Sequence length 557
Sequence
MKVQELRDEAVRRGIASTGSKKELLKRICEDCENEKEEEEEEETDACKDGNVGNGEKIIT
ATKKGSAVLDLWLPDQIKTQYHVLEVGDEIYDAMLNQTNVRNNNNKFYVIQVLESDGGGT
YMVYSRWGRVGVKGQDNIRPYTSKELAIHEFEQKFLAKTKNNWSNRKEFICHPKSYTWLE
MDYSESEKDLSSNMERAPTSEIQPRETQLDPCIANFISLICNVSMMKQHMMEIGYNAEKL
PLGKLSKSTILKGYDVLKRIADVIGLSNRSVLEQLSGEFYTVIPHDFGFKKMREFVIDTP
QKLKKKLEMVEALGEIELATKLLEEVNTMEEDPLYSHYQRLQCELSPVDVVSEEFSMVSK
YTQNTHAKTHSDYTVDIVRIFRVSRKGEDERFKKFSNTKNRKLLWHGSRLTNWTGILSQG
LRIAPPEAPATGYMFGKGVYFADMFSKSANYCYASRAATTGVLLLCEVALGDMVELLDAD
YNADKLPEGKLSTKGVGQTEPNHSEAMTLDDGVVVPLGKPKQSQRGKGALLYNEYIVYNV
DQIRMRYLLQVNFHFKY
Download sequence
Identical sequences Cucsa.205510.2|PACid:16969112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]