SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.219400.1|PACid:16969800 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.219400.1|PACid:16969800
Domain Number 1 Region: 425-663
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.81e-77
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000441
Further Details:      
 
Domain Number 2 Region: 47-186
Classification Level Classification E-value
Superfamily BRCT domain 4.71e-22
Family DNA-repair protein XRCC1 0.048
Further Details:      
 
Domain Number 3 Region: 668-781
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 8.63e-17
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.219400.1|PACid:16969800
Sequence length 1135
Sequence
MNSDSSRSANSSAQKSKRIRDNSSPSNPSGGGGNKRKRSNQKTLGVAWGANSISSSRKSP
FSDFGSYMVEKNRKLHNQFNLDASSASHSGVNSGNQIFQGVSIFVDGFTIPSSQELRGYM
LKYGGRFENYFSRRSVSHIICSNLPDSKIKNLRSFSRGLPVVKPTWILDSVASNKLLSWV
PYQLDQLVNNQPRLSEFFSMKKGPTVEKPKICLTSEKKYETEDSLSPVAMNLKDTTLSEV
NESVGYRAELHSDSEMNLQYNADAKLNETSSDDLEAAKLKDTSISDVDVSIEYKPQFCGS
FEMLPQKDADVEVQKGPSSEKYNYAGEEPGIDDVGQSSEENISSFHGLSASTHNGSTNSD
GSSSSMAAGSSKLQHSTLENPDFVENYFKKSRLHFIGTWRNRYYKRFPRLANGSNSVTSP
INGSSHDQSATIIHVDMDCFFVSVVIRNIPKFKDRPVAVCHSDNPKGTAEISSANYPARS
YGVKAGMFVRDAKALCPHLVIFPYDFKSYEGVADQFYDILHKHCEKVQAVSCDEAFLDIS
GTNNVDPEVLASKIRKEIFDTTGCTASAGIATNMLMARLATKTAKPDGQCYIPLEKVDDY
LNPLPIKDLPGIGHALEEKLKKRSVLTCSQLRMLSKDSLQKDFGLKTGEMLWNYSRGVDN
RAVGLIQESKSIGAEVNWGVRFKDFKDCQCFLLNLCKEVSLRLNGCGVQGRTFTLKIKKR
RKNADEPTKYMGCGDCENLSHSLTVPVATDDLEILQRIVKQLFGFFVIDVKEIRGIGLQV
SKLQNVDISRQDNEKQSNSGTLDQLSADPISHLIQMENNRHHSEALNPVSPPPLCNLDIG
VIRSLPPELFSELNEIYGGKLIDLLSKSRDKNEVFSSSIRVPSQGSGERHALDVFVVSEE
YSCVLFFHLTSLRFTHVFMSFFLKKNSCIYVLFGVFESIIDLLPSSLSQVDPSVLQELPE
PLRDDILKQLPAHRGNELSLEHAIKDQRESGSGVENTSGSVDPLMENDLWSGNPPLWVDK
FKASNCLILELFAEIYTESGLPGNLYEILLRTSSQSWHPSAADSDGWDGAIYGLCELLKQ
YFKLKIELDIEETYVCFRLLKRLAMKSQLFLEVFNIIDPYLQGAVNEIYGGSLKV
Download sequence
Identical sequences Cucsa.219400.1|PACid:16969800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]