SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.232520.1|PACid:16970267 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.232520.1|PACid:16970267
Domain Number 1 Region: 20-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-22
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 274-362
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-17
Family B3 DNA binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.232520.1|PACid:16970267
Sequence length 395
Sequence
MDKVGDSSNKWAEDIYWSHFQFTHFYQILAGGCEQQLVIPNKFSNNLRNKLPDTVTLKGP
SGATWDVGLTSSDDKLYFKRGWQEFVKAHSLEQNDLLVFRYNGMSQFDVLIFDWKSFCEK
EASYFVKICENKKIDSGGQAKRKFREPSLDGFDANINNGAECDSSENIIHDDSMERMIQD
VVSKATNFNGQPEVFSAEPIRTVQTRRKKKTPNKTAIISTPDPVQLSDSDVEATPIKKIG
SYVEQYVSHRRAITEGEKNNALKLAEAASSDTGFKVVMRPSHVYRRFFLFIPTQWVTKNL
SLRNQDIILRVGSDEWPTKFNFTPSRQCGGLTSGWKHFSVDNNLEEFDVCVFEPVNKSSG
PVVLEVKIFRVVEDVIPLTRVASKGNRKPTKAPEA
Download sequence
Identical sequences A0A0A0LRE7
Cucsa.232520.1|PACid:16970267 XP_004152721.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]