SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.237020.1|PACid:16970528 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.237020.1|PACid:16970528
Domain Number 1 Region: 130-291
Classification Level Classification E-value
Superfamily HAD-like 2.01e-32
Family NLI interacting factor-like phosphatase 0.02
Further Details:      
 
Domain Number 2 Region: 208-230,353-442
Classification Level Classification E-value
Superfamily BRCT domain 5.09e-21
Family DNA topoisomerase II binding protein 1, TopBP1 0.027
Further Details:      
 
Weak hits

Sequence:  Cucsa.237020.1|PACid:16970528
Domain Number - Region: 51-126
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0122
Family Rad50 coiled-coil Zn hook 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.237020.1|PACid:16970528
Sequence length 473
Sequence
MSLATNSPAHSSSSDDFAAFLAVDLDSHSSDSSPDEETEGDNNAESVRIKRRKVEKLENS
EEDIMHEVEEQSLEVLSKQQLCSHPGSFGNMCIICGQRLDEESGVTFGYIHKELRLNNDE
INRMRNKEMKELLQRKKLILVLDLDHTLLNSTELRYLTVEEEYLRSQTDSLDDVTKGSLF
LLNSVHTMTKLRPFVHSFLKEASKLFEMYIYTMGERRYAFEMAKLLDPKKEYFSSKVISR
DDGTQKHQKGLDVVLGKESAVLILDDTENAWTKHKENLILMERYHFFASSCRQFGFNCKS
LSELKNDESETDGALTTILKVLKQVHHMFFNEVSGDLVDRDVRQVLKTVRAEVLEGCKVV
FSRVFPTKFQAENHQLWKMVEQLGGTCSTELDQSVTHVVATDAGTEKSRWALKEKKFLVH
PRWIEASNYFWKRQMEENFTLNKEKQRGKECPPKGSIINPNIIKKIASNDKNI
Download sequence
Identical sequences Cucsa.237020.1|PACid:16970528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]