SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.263720.1|PACid:16973246 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.263720.1|PACid:16973246
Domain Number 1 Region: 2-40
Classification Level Classification E-value
Superfamily BRCT domain 0.000016
Family DNA topoisomerase II binding protein 1, TopBP1 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.263720.1|PACid:16973246
Sequence length 82
Sequence
AWIFSSSWLKESYREGRFVDELPYILNDDDYISKYRASLKAAILRAKACLGALFEGYDVC
ISAHAQPPPKTLSPIVKSAGGN
Download sequence
Identical sequences Cucsa.263720.1|PACid:16973246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]