SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.285760.1|PACid:16974899 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.285760.1|PACid:16974899
Domain Number 1 Region: 322-514
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.33e-49
Family DNA polymerase beta-like 0.0000527
Further Details:      
 
Domain Number 2 Region: 181-262
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 4.06e-20
Family DNA polymerase beta, N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 265-320
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 3.11e-16
Family DNA polymerase beta-like, second domain 0.0029
Further Details:      
 
Domain Number 4 Region: 11-103
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000669
Family DNA topoisomerase II binding protein 1, TopBP1 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.285760.1|PACid:16974899
Sequence length 515
Sequence
MAPKRRKSQSLSEDPHGMFAGMVVFLVEKGVQTRRLQIWKQKLVQMGASIEERLSKMVSH
IFASSLDALLEKVDGARLARFKGWLEDSLSSGEKASEDLYTVKVGLDEDGRDKPQQSTPK
KLNLSPNNSEAVSFESGGDSDASTLVTKTATGLEDSKLSIGQTVTSPRTSDFVGNNIALS
YSPPDMNKNITEIFGKLINIYRALGDERRSFSYYKAIPVIEKLPFRIESIDQVKHLPAIG
KSLQDHIQEIVTTGKLSKLEHFETDEKVRTISLFGEVWGIGPATALRLYEKGYRTLDDLQ
KEESLTHAQKLGLKYFDDIKQRIPRNEVQDMESLLKKAGEDVLPGVDILCGGSFRRGKSS
CGDMDIVITHPDGKSHRGFLPKYVKHLKDMKFLREDLIFSTHSEEGTDSGVDTYFGLCTY
PGRELRHRIDLKVYPRDIYAFGLIAWTGNDVLNRRLRLLAESKGFRLDDTGLYPSTQGSG
GKRGARGTATLKFDTEKDVFEFLGFPWLEPHERNL
Download sequence
Identical sequences Cucsa.285760.1|PACid:16974899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]