SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.349260.1|PACid:16979751 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.349260.1|PACid:16979751
Domain Number 1 Region: 927-1105
Classification Level Classification E-value
Superfamily HAD-like 5.96e-32
Family NLI interacting factor-like phosphatase 0.021
Further Details:      
 
Domain Number 2 Region: 1160-1250
Classification Level Classification E-value
Superfamily BRCT domain 1.37e-18
Family BRCT domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.349260.1|PACid:16979751
Sequence length 1251
Sequence
MGKDEILKIEDVEEGEISDTASVEEISEEDFNKLDSSASPKVVVPSKDSNRETRVWTMSD
LYKNYPAMRHGYASGLYNLAWAQAVQNKPLNDIFVMEADLDEKSKHSSSTPFGNAKDDGS
NTTKEEDRVVIDDSGDEMNCDNANGEKEEGELEEGEIDMDTEFVEEVADSKAMLSDSRDM
DINGQEFDLETKELDELLKFIQKTLDGVTIDAAQKSFQEVCSQIHSSIETFVELLQGKVV
PRKDALIQRLYAALRLINSVFCSMNLSEKEEHKEHLSRLLSYVKNCDPPLFSPEQIKSVE
VKMPSTDSLDHLPSMRGSAKEVEIHIPNGVKDMDFYSAYTSTSSQLTPSNKLASDSIPFG
VKGKNNLNILSEGLQSGVSSIKGRGPLLPLLDLHKDHDADSLPSPTREAPTIFSVQKSGN
APTKMAFPVDGSRSHPYETDALKAVSTYQQKFGRSSFSMADRLPSPTPSEEHDGGGDIGG
EVSSSSIIRSLKSSNVSKPGQKSNSASNVSTGLFPNMDSSSTRVLISPLNVAPPSSVSNP
TVKPLAKSRDPRLRIVNSDASGMDLNPRTMASVQSSSILESAATLHLRKQKMDGEPNTDG
PEVKRLRIGSQNLAVAASDVRAVSGSGGWLEDTMPAGPRLFNRNQMEIAEANATEKSNVT
NNSGSGNECTPTVNNSNDASLPSLLKDIVVNPTMLLNLLKMSQQQQLAAELKLKSSEPEK
NAICPTSLNPCQGSSPLINAPVATSGILQQSAGTPSASPVVAVGRQDDLGKVRMKPRDPR
RVLHGNSLQKVGSLGNDQLKGVVPTASNTEGSRDIPNGHKQEGQGDSKLASSQTILPDIG
RQFTNNLKNIADIMSVPSPPTSSPNSSSKPVGSSSMDSKPVTTAFQAVDMAASSRSQGAW
GDLEHLFDSYDDKQKAAIQRERARRIEEQKKMFAARKLCLVLDLDHTLLNSAKFVEVDPV
HDEILRKKEEQDREKAQRHLFRFPHMGMWTKLRPGVWNFLEKASELYELHLYTMGNKLYA
TEMAKVLDPKGVLFAGRVISRGDDGDPLDGDDRVPKSKDLEGVLGMESGVVIIDDSIRVW
PHNKMNLIVVERYTYFPCSRRQFGLLGPSLLEIDHDERPEDGTLASSLGVIQRIHQSFFS
NPELDQVDVRTILSAEQQKILAGCRIVFSRVFPVGEANPHLHPLWQTAEQFGAQCTNQID
EQVTHVVANSLGTDKVNWALSTGRFVVHPGWVEASALLYRRATEQDFAIKP
Download sequence
Identical sequences A0A0A0KAB9
Cucsa.349260.1|PACid:16979751 XP_011656791.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]