SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Cucsa.349260.2|PACid:16979752 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.349260.2|PACid:16979752
Domain Number 1 Region: 664-842
Classification Level Classification E-value
Superfamily HAD-like 4.03e-32
Family NLI interacting factor-like phosphatase 0.021
Further Details:      
 
Domain Number 2 Region: 897-987
Classification Level Classification E-value
Superfamily BRCT domain 1.12e-18
Family BRCT domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.349260.2|PACid:16979752
Sequence length 988
Sequence
MNLSEKEEHKEHLSRLLSYVKNCDPPLFSPEQIKSVEVKMPSTDSLDHLPSMRGSAKEVE
IHIPNGVKDMDFYSAYTSTSSQLTPSNKLASDSIPFGVKGKNNLNILSEGLQSGVSSIKG
RGPLLPLLDLHKDHDADSLPSPTREAPTIFSVQKSGNAPTKMAFPVDGSRSHPYETDALK
AVSTYQQKFGRSSFSMADRLPSPTPSEEHDGGGDIGGEVSSSSIIRSLKSSNVSKPGQKS
NSASNVSTGLFPNMDSSSTRVLISPLNVAPPSSVSNPTVKPLAKSRDPRLRIVNSDASGM
DLNPRTMASVQSSSILESAATLHLRKQKMDGEPNTDGPEVKRLRIGSQNLAVAASDVRAV
SGSGGWLEDTMPAGPRLFNRNQMEIAEANATEKSNVTNNSGSGNECTPTVNNSNDASLPS
LLKDIVVNPTMLLNLLKMSQQQQLAAELKLKSSEPEKNAICPTSLNPCQGSSPLINAPVA
TSGILQQSAGTPSASPVVAVGRQDDLGKVRMKPRDPRRVLHGNSLQKVGSLGNDQLKGVV
PTASNTEGSRDIPNGHKQEGQGDSKLASSQTILPDIGRQFTNNLKNIADIMSVPSPPTSS
PNSSSKPVGSSSMDSKPVTTAFQAVDMAASSRSQGAWGDLEHLFDSYDDKQKAAIQRERA
RRIEEQKKMFAARKLCLVLDLDHTLLNSAKFVEVDPVHDEILRKKEEQDREKAQRHLFRF
PHMGMWTKLRPGVWNFLEKASELYELHLYTMGNKLYATEMAKVLDPKGVLFAGRVISRGD
DGDPLDGDDRVPKSKDLEGVLGMESGVVIIDDSIRVWPHNKMNLIVVERYTYFPCSRRQF
GLLGPSLLEIDHDERPEDGTLASSLGVIQRIHQSFFSNPELDQVDVRTILSAEQQKILAG
CRIVFSRVFPVGEANPHLHPLWQTAEQFGAQCTNQIDEQVTHVVANSLGTDKVNWALSTG
RFVVHPGWVEASALLYRRATEQDFAIKP
Download sequence
Identical sequences Cucsa.349260.2|PACid:16979752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]